UTP18_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: UTP18_ARATH
• UniProt AC: Q9FMU5
• Protein Name: U3 small nucleolar RNA-associated protein 18 homolog
• Gene Name: At5g14050
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 546
• Subcellular Localization: Nucleus, nucleolus.
• Protein Description: Involved in nucleolar processing of pre-18S ribosomal RNA..
• Protein Sequence: MSLSQNAPKSKGIKREELKKQYEDVEDEEEIGSDDDLTRGKRRKTEKEKQKLEESELVEMKKLENLIFGSLYSPVTFGKEEEEDGSALFHVDRSAVRQIPDYEDDGDDDEELSDEENGQVVAIRKGEAAWEDEEEKQINVDIASVNRLRKLRKEENEGLISGSEYIARLRAHHAKLNPGTDWARPDSQIVDGESSDDDDTQDGGVDDILRTNEDLVVKSRGNKLCAGRLEYSKLVDANAADPSNGPINSVHFHQNAQLLLTAGLDRRLRFFQIDGKRNTKIQSIFLEDCPIRKAAFLPNGSQVIVSGRRKFFYSFDLEKAKFDKIGPLVGREEKSLEYFEVSQDSNTIAFVGNEGYILLVSTKTKELIGTLKMNGSVRSLAFSEDGKHLLSSGGDGQVYVWDLRTMKCLYKGVDEGSTCGTSLCSSLNGALFASGTDRGIVNIYKKSEFVGGKRKPIKTVDNLTSKIDFMKFNHDAQILAIVSTMNKNSVKLVHVPSLTVFSNWPPPNSTMHYPRCLDFSPGSGFMAMGNAAGKVLLYKLHHYQNA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
33	Phosphorylation	EDEEEIGSDDDLTRG CCHHHHCCCCCCCHH	43.45	30291188
38	Phosphorylation	IGSDDDLTRGKRRKT HCCCCCCCHHHHHHH	44.35	23776212
102	Phosphorylation	AVRQIPDYEDDGDDD HHHCCCCCCCCCCCC	18.86	23776212
113	Phosphorylation	GDDDEELSDEENGQV CCCCCCCCCCCCCEE	46.38	30291188
180	Phosphorylation	HAKLNPGTDWARPDS HHCCCCCCCCCCCCC	29.62	23776212
187	Phosphorylation	TDWARPDSQIVDGES CCCCCCCCCCCCCCC	25.21	23776212
194	Phosphorylation	SQIVDGESSDDDDTQ CCCCCCCCCCCCCCC	44.59	23776212
195	Phosphorylation	QIVDGESSDDDDTQD CCCCCCCCCCCCCCC	40.53	23776212
200	Phosphorylation	ESSDDDDTQDGGVDD CCCCCCCCCCCCHHH	35.24	23776212

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of UTP18_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of UTP18_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of UTP18_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of UTP18_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.

Related Literatures of Post-Translational Modification

Phosphorylation

"Large-scale Arabidopsis phosphoproteome profiling reveals novelchloroplast kinase substrates and phosphorylation networks.";
Reiland S., Messerli G., Baerenfaller K., Gerrits B., Endler A.,Grossmann J., Gruissem W., Baginsky S.;
Plant Physiol. 150:889-903(2009).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-33, AND MASSSPECTROMETRY.
PubMed: 19376835