dbPTM

UT1_RAT - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	UT1_RAT
UniProt AC	P97689
Protein Name	Urea transporter 1
Gene Name	Slc14a1
Organism	Rattus norvegicus (Rat).
Sequence Length	384
Subcellular Localization	Cell membrane Multi-pass membrane protein . Basolateral cell membrane Multi-pass membrane protein. Restricted to the basolateral membrane in various portions of the urothelium..
Protein Description	Urea channel that facilitates transmembrane urea transport down a concentration gradient. A constriction of the transmembrane channel functions as selectivity filter through which urea is expected to pass in dehydrated form. The rate of urea conduction is increased by hypotonic stress. Plays an important role in the kidney medulla collecting ducts, where it allows rapid equilibration between the lumen of the collecting ducts and the interstitium, and thereby prevents water loss driven by the high concentration of urea in the urine. Facilitates urea transport across erythrocyte membranes. May also play a role in transmembrane water transport, possibly by indirect means..
Protein Sequence	MEDIPTMVKVDRGESQILSCRGRRCGLKVLGYVTGDMKEFANWLKDKPVVLQFMDWILRGISQVVFVSNPISGILILAGLLVQNPWWALCGCVGTVVSTLTALLLSQDRSAIAAGLQGYNATLVGILMAVFSDKGDYFWWLIFPVSAMSMTCPVFSSALSSLFSKWDLPVFTLPFNMALSLYLSATGHYNTFFPSKLFMPVSSVPNITWSELSALELLKSLPVGVGQIYGCDNPWTGAIFLCAILLSSPLMCLHAAIGSLLGVIAGLSLAAPFKDIYSGLWGFNSSLACIAIGGMFMALTWQTHLLALACALFTAYFGACMTHLMAAVHLPACTWSFCLATLLFLLLTTENPNIYRMPLSKVTYSEENRIFYLQNKKRVVDSPL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
15	Phosphorylation	VKVDRGESQILSCRG EEECCCCCCEEEECC	25.91	27097102
19	Phosphorylation	RGESQILSCRGRRCG CCCCCEEEECCCCCC	11.91	27097102
206	N-linked_Glycosylation	MPVSSVPNITWSELS CCCCCCCCCCHHHHH	42.01	-
361	Ubiquitination	IYRMPLSKVTYSEEN CEECCCCCCCCCCCC	46.40	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of UT1_RAT !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of UT1_RAT !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of UT1_RAT !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of UT1_RAT !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of UT1_RAT

Related Literatures of Post-Translational Modification