US11_HCMVM - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: US11_HCMVM
• UniProt AC: Q6SVZ5
• Protein Name: Membrane glycoprotein US11
• Gene Name: US11
• Organism: Human cytomegalovirus (strain Merlin) (HHV-5) (Human herpesvirus 5).
• Sequence Length: 215
• Subcellular Localization: Host endoplasmic reticulum membrane; Single-pass type I membrane protein.
• Protein Description: Participates in the inhibition of the host immune response. Redirects newly synthesized MHC class I heavy chains via the SEC61 translocon to the cytosol where they undergo proteasome-dependent destruction. In consequence, infected cells are masked for immune recognition by cytotoxic T-lymphocytes (By similarity)..
• Protein Sequence: MNLVMLILALWAPVAGSMPELSLTLFDEPPPLVETEPLPPLPDVSEYRVEYSEARCVLRSGGRLEALWTLRGNLSVPTPTPRVYYQTLEGYADRVPTPVEDISESLVAKRYWLRDYRVPQRTKLVLFYFSPCHQCQTYYVECEPRCLVPWVPLWSSLEDIERLLFEDRRLMAYYALTIKSAQYTLMMVAVIQVFWGLYVKGWLHRHFPWMFSDQW

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
73	N-linked_Glycosylation	ALWTLRGNLSVPTPT EEEEEECCCCCCCCC	23.78	UniProtKB CARBOHYD

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of US11_HCMVM !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of US11_HCMVM !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of US11_HCMVM !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TRAM1_HUMAN	TRAM1	physical	19121997

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.