UniProt ID | UREG_ARATH | |
---|---|---|
UniProt AC | O64700 | |
Protein Name | Urease accessory protein G | |
Gene Name | UREG | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 275 | |
Subcellular Localization | ||
Protein Description | Required for the maturation and activation of urease via the functional incorporation of the urease nickel metallocenter.. | |
Protein Sequence | MASHDHHHHHHDHEHDHEKSDGGEGKASWVGKDGKVYHSHDGLAPHSHEPIYSPGYFSRRAPPLHDRNFSERAFTVGIGGPVGTGKTALMLALCRFLRDKYSLAAVTNDIFTKEDGEFLVKNGALPEERIRAVETGGCPHAAIREDISINLGPLEELSNLFKADLLLCESGGDNLAANFSRELADYIIYIIDVSAGDKIPRKGGPGITQADLLVINKTDLAAAVGADLSVMERDSLRMRDGGPFVFAQVKHGLGVEEIVNHVMHSWEHATGKKRQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
37 | Phosphorylation | VGKDGKVYHSHDGLA ECCCCCEEECCCCCC | 27643528 | ||
39 | Phosphorylation | KDGKVYHSHDGLAPH CCCCEEECCCCCCCC | 27643528 | ||
47 | Phosphorylation | HDGLAPHSHEPIYSP CCCCCCCCCCCCCCC | 27643528 | ||
52 | Phosphorylation | PHSHEPIYSPGYFSR CCCCCCCCCCCCCCC | 27643528 | ||
53 | Phosphorylation | HSHEPIYSPGYFSRR CCCCCCCCCCCCCCC | 27545962 | ||
56 | Phosphorylation | EPIYSPGYFSRRAPP CCCCCCCCCCCCCCC | 27643528 | ||
58 | Phosphorylation | IYSPGYFSRRAPPLH CCCCCCCCCCCCCCC | 27643528 | ||
180 | Phosphorylation | DNLAANFSRELADYI CCHHHHHHHHHHCEE | 25368622 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of UREG_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UREG_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UREG_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of UREG_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...