UniProt ID | UNG_HCMVA | |
---|---|---|
UniProt AC | P16769 | |
Protein Name | Uracil-DNA glycosylase {ECO:0000255|HAMAP-Rule:MF_04046} | |
Gene Name | UL114 | |
Organism | Human cytomegalovirus (strain AD169) (HHV-5) (Human herpesvirus 5). | |
Sequence Length | 250 | |
Subcellular Localization | Host nucleus . | |
Protein Description | Excises uracil residues from the DNA which can arise as a result of misincorporation of dUMP residues by DNA polymerase or due to deamination of cytosine.; Excises uracil residues from the DNA which can arise as a result of misincorporation of dUMP residues by DNA polymerase or deamination of cytosines. Therefore may reduce deleterious uracil incorporation into the viral genome, particularly in terminally differentiated cells which lack DNA repair enzymes.. | |
Protein Sequence | MALKQWMLANIADNKGSLLTPDEQARVFCLSADWIRFLSLPDHDTVLLRDTVAAVEGARQLEMVYPAPEHVHRWSYLCPPEQVRVVIVGQDPYCDGSASGLAFGTLAGRPPPPSLNNVFRELARTVDGFQRPASGCLDAWARRGVLLLNTVFTVVHGQPGSHRHLGWQTLSNHVIRRLSERREHLVFMLWGADAHTCEYLIDRRRHLVLKSCHPSPRNTTRAFVGNDHFILANAYLDTHYRETMDWRLCG | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of UNG_HCMVA !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of UNG_HCMVA !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UNG_HCMVA !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UNG_HCMVA !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SNF5_HUMAN | SMARCB1 | physical | 22479537 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...