| UniProt ID | UMPS_MOUSE | |
|---|---|---|
| UniProt AC | P13439 | |
| Protein Name | Uridine 5'-monophosphate synthase | |
| Gene Name | Umps | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 481 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MEVASQALGPLVTELYDVQAFKFGSFVLKSGLSSPVYIDLRGIVSRPRLLSQVADILFQTAKNAGISFDSVCGVPYTALPLATVICSANHIPMLIRRKETKDYGTKRLVEGEINPGQTCLVIEDVVTSGASVLETVEVLQKEGLKVTDAIVLLDREQGGKDKLQAQGIRLHAVCTLSQMLEILQQQEKIDADMVGRVKRFIQENVFSAANHNGLPPPEKKACKELSFGARAELPGTHPLASKLLRLMQKKETNLCLSADVSEARELLQLADALGPSICMLKTHVDILNDFTLDVMEELTALAKRHEFLIFEDRKFADIGNTVKKQYESGTFKIASWADIVNAHVVPGSGVVKGLQEVGLPLHRACLLIAEMSSAGSLATGNYTKAAVGMAEEHCEFVIGFISGSRVSMKPEFLHLTPGVQLETGGDHLGQQYNSPQEVIGKRGSDVIIVGRGILAAANRLEAAEMYRKAAWEAYLSRLAVQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 37 | Phosphorylation | SGLSSPVYIDLRGIV CCCCCCEEEECCHHH | 7.66 | 22817900 | |
| 51 | Phosphorylation | VSRPRLLSQVADILF HCCHHHHHHHHHHHH | 27.48 | 26745281 | |
| 162 | Acetylation | REQGGKDKLQAQGIR HHHCCHHHHHHCHHH | 46.08 | 22826441 | |
| 162 | Malonylation | REQGGKDKLQAQGIR HHHCCHHHHHHCHHH | 46.08 | 26320211 | |
| 174 | S-nitrosocysteine | GIRLHAVCTLSQMLE HHHHHHHHHHHHHHH | 3.08 | - | |
| 223 | Ubiquitination | PPEKKACKELSFGAR CCCHHHHHHCCCCCC | 67.56 | 22790023 | |
| 278 | S-palmitoylation | DALGPSICMLKTHVD HHHCHHEEEEEHHHH | 2.83 | 28526873 | |
| 324 | Malonylation | DIGNTVKKQYESGTF CCCHHHHHHHHCCCE | 54.50 | 26320211 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of UMPS_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UMPS_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UMPS_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of UMPS_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...