UniProt ID | UMPS_MOUSE | |
---|---|---|
UniProt AC | P13439 | |
Protein Name | Uridine 5'-monophosphate synthase | |
Gene Name | Umps | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 481 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MEVASQALGPLVTELYDVQAFKFGSFVLKSGLSSPVYIDLRGIVSRPRLLSQVADILFQTAKNAGISFDSVCGVPYTALPLATVICSANHIPMLIRRKETKDYGTKRLVEGEINPGQTCLVIEDVVTSGASVLETVEVLQKEGLKVTDAIVLLDREQGGKDKLQAQGIRLHAVCTLSQMLEILQQQEKIDADMVGRVKRFIQENVFSAANHNGLPPPEKKACKELSFGARAELPGTHPLASKLLRLMQKKETNLCLSADVSEARELLQLADALGPSICMLKTHVDILNDFTLDVMEELTALAKRHEFLIFEDRKFADIGNTVKKQYESGTFKIASWADIVNAHVVPGSGVVKGLQEVGLPLHRACLLIAEMSSAGSLATGNYTKAAVGMAEEHCEFVIGFISGSRVSMKPEFLHLTPGVQLETGGDHLGQQYNSPQEVIGKRGSDVIIVGRGILAAANRLEAAEMYRKAAWEAYLSRLAVQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
37 | Phosphorylation | SGLSSPVYIDLRGIV CCCCCCEEEECCHHH | 7.66 | 22817900 | |
51 | Phosphorylation | VSRPRLLSQVADILF HCCHHHHHHHHHHHH | 27.48 | 26745281 | |
162 | Acetylation | REQGGKDKLQAQGIR HHHCCHHHHHHCHHH | 46.08 | 22826441 | |
162 | Malonylation | REQGGKDKLQAQGIR HHHCCHHHHHHCHHH | 46.08 | 26320211 | |
174 | S-nitrosocysteine | GIRLHAVCTLSQMLE HHHHHHHHHHHHHHH | 3.08 | - | |
223 | Ubiquitination | PPEKKACKELSFGAR CCCHHHHHHCCCCCC | 67.56 | 22790023 | |
278 | S-palmitoylation | DALGPSICMLKTHVD HHHCHHEEEEEHHHH | 2.83 | 28526873 | |
324 | Malonylation | DIGNTVKKQYESGTF CCCHHHHHHHHCCCE | 54.50 | 26320211 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of UMPS_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UMPS_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UMPS_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of UMPS_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...