UniProt ID | UMAD1_HUMAN | |
---|---|---|
UniProt AC | C9J7I0 | |
Protein Name | UBAP1-MVB12-associated (UMA)-domain containing protein 1 {ECO:0000312|HGNC:HGNC:48955} | |
Gene Name | UMAD1 {ECO:0000312|HGNC:HGNC:48955} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 137 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MFHFFRKPPESKKPSVPETEADGFVLLGDTTDEQRMTARGKTSDIEANQPLETNKENSSSVTVSDPEMENKAGQTLENSSLMAELLSDVPFTLAPHVLAVQGTITDLPDHLLSYDGSENLSRFWYDFTLENSVLCDS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
7 | Phosphorylation | -MFHFFRKPPESKKP -CCCCCCCCCCCCCC | 28985074 | ||
8 | Phosphorylation | MFHFFRKPPESKKPS CCCCCCCCCCCCCCC | 21815630 | ||
24 | Phosphorylation | PETEADGFVLLGDTT CCCCCCCEEEECCCC | 25849741 | ||
25 | Phosphorylation | ETEADGFVLLGDTTD CCCCCCEEEECCCCH | 25627689 | ||
27 | Phosphorylation | EADGFVLLGDTTDEQ CCCCEEEECCCCHHH | 22199227 | ||
29 | Phosphorylation | DGFVLLGDTTDEQRM CCEEEECCCCHHHHH | 22199227 | ||
41 | Ubiquitination | QRMTARGKTSDIEAN HHHHHCCCCCCCCCC | - | ||
64 | Phosphorylation | NSSSVTVSDPEMENK CCCCCEECCHHHCCC | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of UMAD1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UMAD1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UMAD1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of UMAD1_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...