| UniProt ID | UMAD1_HUMAN | |
|---|---|---|
| UniProt AC | C9J7I0 | |
| Protein Name | UBAP1-MVB12-associated (UMA)-domain containing protein 1 {ECO:0000312|HGNC:HGNC:48955} | |
| Gene Name | UMAD1 {ECO:0000312|HGNC:HGNC:48955} | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 137 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MFHFFRKPPESKKPSVPETEADGFVLLGDTTDEQRMTARGKTSDIEANQPLETNKENSSSVTVSDPEMENKAGQTLENSSLMAELLSDVPFTLAPHVLAVQGTITDLPDHLLSYDGSENLSRFWYDFTLENSVLCDS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 7 | Phosphorylation | -MFHFFRKPPESKKP -CCCCCCCCCCCCCC | 28985074 | ||
| 8 | Phosphorylation | MFHFFRKPPESKKPS CCCCCCCCCCCCCCC | 21815630 | ||
| 24 | Phosphorylation | PETEADGFVLLGDTT CCCCCCCEEEECCCC | 25849741 | ||
| 25 | Phosphorylation | ETEADGFVLLGDTTD CCCCCCEEEECCCCH | 25627689 | ||
| 27 | Phosphorylation | EADGFVLLGDTTDEQ CCCCEEEECCCCHHH | 22199227 | ||
| 29 | Phosphorylation | DGFVLLGDTTDEQRM CCEEEECCCCHHHHH | 22199227 | ||
| 41 | Ubiquitination | QRMTARGKTSDIEAN HHHHHCCCCCCCCCC | - | ||
| 64 | Phosphorylation | NSSSVTVSDPEMENK CCCCCEECCHHHCCC | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of UMAD1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UMAD1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UMAD1_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of UMAD1_HUMAN !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...