UniProt ID | UL76_HCMVM | |
---|---|---|
UniProt AC | Q6SW66 | |
Protein Name | Protein UL76 | |
Gene Name | UL76 | |
Organism | Human cytomegalovirus (strain Merlin) (HHV-5) (Human herpesvirus 5). | |
Sequence Length | 325 | |
Subcellular Localization | Virion. Host cytoplasm. Host nucleus, host nucleolus. Host Golgi apparatus. | |
Protein Description | May participate in nuclear egress of viral particles. Plays a role in the dispersal of several host nucleolar proteins including NCL/nucleolin and NPM1. Since deletion of host NCL/nucleolin negatively impact on nuclear egress, UL76 supposedly acts on this process through its effect on host nucleoli (By similarity). Induces cell cycle arrest in host cells at the G2/M phase following by apoptosis. The mechanism involves the inhibition of host mitotic complex cyclinB/CDK1.. | |
Protein Sequence | MPSGCGDDADSTGNALRRLPHVRKRIGKRKHLDIYRRLLRVFPSFVALNRLLGGLFPPELQKYRRRLFIEVRLSRRIPDCVLVFLPPDSGSRGIVYCYVIEFKTTYSDADDQSVRWHATHSLQYAEGLRQLKGALVDFDFLRLPRGGGQVWSVVPSLVFFQQKADRPSFYRAFRSGRFDLCTDSVLDYLGRRQDESVAHLLAATRRRLLRAARGKRAALPRARASAVAGGRGGGNARRGLARGRAHGPGAQTVSASGAEGSGSQGTDLLRGSRRARVRGGGAVEPAVRARRRTVAADAATTTVSSAFVVPRDRRGRSFRRPTRSL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of UL76_HCMVM !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of UL76_HCMVM !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UL76_HCMVM !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UL76_HCMVM !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PSMD4_HUMAN | PSMD4 | physical | 23966401 | |
UBC_HUMAN | UBC | physical | 23966401 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...