| UniProt ID | UIF_MOUSE | |
|---|---|---|
| UniProt AC | Q91Z49 | |
| Protein Name | UAP56-interacting factor | |
| Gene Name | Fyttd1 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 317 | |
| Subcellular Localization | Nucleus, nucleoplasm. Nucleus speckle. | |
| Protein Description | Required for mRNA export from the nucleus to the cytoplasm. Acts as an adapter that uses the DDX39B/UAP56-NFX1 pathway to ensure efficient mRNA export and delivering to the nuclear pore. Associates with spliced and unspliced mRNAs simultaneously with ALYREF/THOC4 (By similarity).. | |
| Protein Sequence | MNRFGTRLVGATATPPPPPKARSNENLDKIDMSLDDIIKLNRKEGKKQNFPRLNRRLQQSGTRQFRMRVRWGIQQNSGFGKTSLSRRGRVLPGKRRPYGVITGLAARKATGIRKGISPMNRPPLSDKNIERYFPALKRKTSLLRQNEVQRKQVAVLKRPNQLNRKNNIPANFTRNGNKLSHQKDTRQATFLFRRGLKVQTQLNTEQLIDDVVAKRTRQWRTSTTNGGILTVSIDNPGAVQCPVTQKPRLTRTAVPSFLTKREQSDVKKVPKGVPLQFDINSVGKQTGMTLNERFGILKEQRANLTFSKGGSRFVTVG | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 1 | Acetylation | -------MNRFGTRL -------CCCCCCCC | 7.98 | - | |
| 6 | Phosphorylation | --MNRFGTRLVGATA --CCCCCCCCCCCCC | 20.37 | 24719451 | |
| 12 | Phosphorylation | GTRLVGATATPPPPP CCCCCCCCCCCCCCC | 25.74 | 25159016 | |
| 14 | Phosphorylation | RLVGATATPPPPPKA CCCCCCCCCCCCCCC | 31.79 | 23527152 | |
| 23 | Phosphorylation | PPPPKARSNENLDKI CCCCCCCCCCCHHHH | 54.04 | 25521595 | |
| 33 | Phosphorylation | NLDKIDMSLDDIIKL CHHHHCCCHHHHHHH | 25.54 | 25367039 | |
| 60 | Phosphorylation | LNRRLQQSGTRQFRM HHHHHHHHCCHHHHH | 29.22 | - | |
| 81 | Ubiquitination | QQNSGFGKTSLSRRG CCCCCCCCCCCCCCC | 32.45 | 22790023 | |
| 117 | Phosphorylation | TGIRKGISPMNRPPL HCCCCCCCCCCCCCC | 27.11 | 25159016 | |
| 125 | Phosphorylation | PMNRPPLSDKNIERY CCCCCCCCCCHHHHH | 52.92 | - | |
| 141 | Phosphorylation | PALKRKTSLLRQNEV HHHHHHHHHHHHCHH | 28.57 | 24719451 | |
| 171 (in isoform 2) | Phosphorylation | - | 33.21 | - | |
| 210 (in isoform 2) | Phosphorylation | - | 29.78 | - | |
| 216 (in isoform 2) | Phosphorylation | - | 26.89 | - | |
| 308 | Ubiquitination | RANLTFSKGGSRFVT HCCEEECCCCCEEEE | 64.20 | 22790023 | |
| 311 | Phosphorylation | LTFSKGGSRFVTVG- EEECCCCCEEEEEC- | 31.08 | 22817900 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of UIF_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UIF_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UIF_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of UIF_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "Solid tumor proteome and phosphoproteome analysis by high resolutionmass spectrometry."; Zanivan S., Gnad F., Wickstroem S.A., Geiger T., Macek B., Cox J.,Faessler R., Mann M.; J. Proteome Res. 7:5314-5326(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-23, AND MASSSPECTROMETRY. | |
