UniProt ID | UHMK1_HUMAN | |
---|---|---|
UniProt AC | Q8TAS1 | |
Protein Name | Serine/threonine-protein kinase Kist | |
Gene Name | UHMK1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 419 | |
Subcellular Localization | Nucleus . | |
Protein Description | Upon serum stimulation, phosphorylates CDKN1B/p27Kip1, thus controlling CDKN1B subcellular location and cell cycle progression in G1 phase. May be involved in trafficking and/or processing of RNA (By similarity).. | |
Protein Sequence | MAGSGCAWGAEPPRFLEAFGRLWQVQSRLGSGSSASVYRVRCCGNPGSPPGALKQFLPPGTTGAAASAAEYGFRKERAALEQLQGHRNIVTLYGVFTIHFSPNVPSRCLLLELLDVSVSELLLYSSHQGCSMWMIQHCARDVLEALAFLHHEGYVHADLKPRNILWSAENECFKLIDFGLSFKEGNQDVKYIQTDGYRAPEAELQNCLAQAGLQSDTECTSAVDLWSLGIILLEMFSGMKLKHTVRSQEWKANSSAIIDHIFASKAVVNAAIPAYHLRDLIKSMLHDDPSRRIPAEMALCSPFFSIPFAPHIEDLVMLPTPVLRLLNVLDDDYLENEEEYEDVVEDVKEECQKYGPVVSLLVPKENPGRGQVFVEYANAGDSKAAQKLLTGRMFDGKFVVATFYPLSAYKRGYLYQTLL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
54 | Ubiquitination | GSPPGALKQFLPPGT CCCCCHHHHHCCCCC | 38.17 | - | |
116 | Ubiquitination | LLLELLDVSVSELLL HHHHHHCCCHHHHHH | 6.50 | 21963094 | |
181 | Phosphorylation | KLIDFGLSFKEGNQD HHHEECCCCCCCCCC | 34.35 | 24719451 | |
183 | Ubiquitination | IDFGLSFKEGNQDVK HEECCCCCCCCCCEE | 62.43 | - | |
190 (in isoform 1) | Ubiquitination | - | 44.95 | 21906983 | |
190 | Ubiquitination | KEGNQDVKYIQTDGY CCCCCCEEEEECCCC | 44.95 | 21906983 | |
190 (in isoform 2) | Ubiquitination | - | 44.95 | 21906983 | |
191 | Ubiquitination | EGNQDVKYIQTDGYR CCCCCEEEEECCCCC | 9.71 | 21963094 | |
197 | Phosphorylation | KYIQTDGYRAPEAEL EEEECCCCCCCHHHH | 13.35 | - | |
208 | Ubiquitination | EAELQNCLAQAGLQS HHHHHHHHHHHCCCC | 5.33 | 22817900 | |
251 | Ubiquitination | TVRSQEWKANSSAII HHHCCCHHCCHHHHH | 36.62 | - | |
265 | Ubiquitination | IDHIFASKAVVNAAI HHHHHHCHHHHHHHC | 41.59 | 21963094 | |
282 (in isoform 1) | Ubiquitination | - | 36.79 | 21906983 | |
282 | Ubiquitination | YHLRDLIKSMLHDDP HHHHHHHHHHCCCCH | 36.79 | 22817900 | |
282 (in isoform 2) | Ubiquitination | - | 36.79 | 21906983 | |
283 | Phosphorylation | HLRDLIKSMLHDDPS HHHHHHHHHCCCCHH | 21.41 | 27251275 | |
290 | Ubiquitination | SMLHDDPSRRIPAEM HHCCCCHHHCCCHHH | 40.98 | 29967540 | |
290 | Phosphorylation | SMLHDDPSRRIPAEM HHCCCCHHHCCCHHH | 40.98 | - | |
309 | Ubiquitination | PFFSIPFAPHIEDLV CCCCCCCCCCHHHHH | 6.87 | 22817900 | |
313 | Ubiquitination | IPFAPHIEDLVMLPT CCCCCCHHHHHCCCH | 42.11 | 22817900 | |
340 | Phosphorylation | YLENEEEYEDVVEDV HCCCHHHHHHHHHHH | 22.25 | 27642862 | |
364 | Ubiquitination | VVSLLVPKENPGRGQ EEEEEEECCCCCCCE | 63.74 | 29967540 | |
383 (in isoform 1) | Ubiquitination | - | 53.10 | 21906983 | |
383 | Ubiquitination | YANAGDSKAAQKLLT ECCCCCCHHHHHHHH | 53.10 | 27667366 | |
387 | Ubiquitination | GDSKAAQKLLTGRMF CCCHHHHHHHHCCCC | 40.51 | 22817900 | |
397 | Ubiquitination | TGRMFDGKFVVATFY HCCCCCCEEEEEEEC | 36.51 | - | |
410 | Ubiquitination | FYPLSAYKRGYLYQT ECCHHHHHCCCHHHH | 38.78 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of UHMK1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UHMK1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UHMK1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of UHMK1_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...