dbPTM

UGPA1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	UGPA1_SCHPO
UniProt AC	P78811
Protein Name	Probable UTP--glucose-1-phosphate uridylyltransferase
Gene Name	fyu1
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	506
Subcellular Localization	Cytoplasm . Nucleus .
Protein Description	Plays a central role as a glucosyl donor in cellular metabolic pathways..
Protein Sequence	MDLAPRPLGRQHSKSQSAFAFDNTATSIAASTMKNELNHLASTVKDPLAKKAFQKEMDNFFSLFSRYLQEDARGSEINWDLVESPKPEQVVEYDTITEAGGLSRDYLNKLAVLKLNGGLGTTMGCVGPKSIIEVRDGNSFLDLSVRQIEHLNRKYNVNVPFVLMNSFNTDEATAKVIKKYEAHKIDILTFNQSRYPRVHKETLLPVPHTADSAIDEWYPPGHGDVFEALTNSGIIDTLIAQGKEYLFVSNIDNLGAVVDLNILNHMVETNAEYLMELTNKTKADVKGGTLIDYDGNVRLLEIAQVPPQHVEEFKSIKKFKYFNTNNLWFHLPSVKRVVNNHELSMEIIPNKKTIKHKGENINIIQLETAAGAAIRHFKNAHGVNVPRRRFLPVKTCSDLLLVKSDLYSINHGQVEMNPRRFGGTAPLVKLGAHFKKVADFSAHIPSIPKILELDHLTITGDVNIGRNVTLKGTVIIVASDANRIDIPNGSVLENCVITGNLNILEH

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
13	Phosphorylation	RPLGRQHSKSQSAFA CCCCCCCCCCCCEEC	26.18	24763107
15	Phosphorylation	LGRQHSKSQSAFAFD CCCCCCCCCCEECCC	32.17	28889911
17	Phosphorylation	RQHSKSQSAFAFDNT CCCCCCCCEECCCCH	32.23	28889911
24	Phosphorylation	SAFAFDNTATSIAAS CEECCCCHHHHHHHH	32.91	25720772
26	Phosphorylation	FAFDNTATSIAASTM ECCCCHHHHHHHHHH	20.73	21712547
84	Phosphorylation	INWDLVESPKPEQVV CCCCCCCCCCHHHEE	30.64	29996109
130	Phosphorylation	MGCVGPKSIIEVRDG CCCCCCCEEEEEECC	31.75	25720772
139	Phosphorylation	IEVRDGNSFLDLSVR EEEECCCCEEEEEHH	32.49	25720772

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of UGPA1_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of UGPA1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of UGPA1_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of UGPA1_SCHPO !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of UGPA1_SCHPO

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Phosphoproteome analysis of fission yeast."; Wilson-Grady J.T., Villen J., Gygi S.P.; J. Proteome Res. 7:1088-1097(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-15 AND SER-17, AND MASSSPECTROMETRY.	18257517 [Abstract]