UniProt ID | UGDH4_ARATH | |
---|---|---|
UniProt AC | Q9FM01 | |
Protein Name | UDP-glucose 6-dehydrogenase 4 | |
Gene Name | UGD4 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 480 | |
Subcellular Localization | ||
Protein Description | Involved in the biosynthesis of UDP-glucuronic acid (UDP-GlcA), providing nucleotide sugars for cell-wall polymers.. | |
Protein Sequence | MVKICCIGAGYVGGPTMAVIALKCPDIEVAVVDISVPRINAWNSDQLPIYEPGLDDIVKQCRGKNLFFSTDVEKHVREADIVFVSVNTPTKTTGLGAGKAADLTYWESAARMIADVSVSDKIVVEKSTVPVKTAEAIEKILMHNSKGIKFQILSNPEFLAEGTAIADLFNPDRVLIGGRETPEGFKAVQTLKEVYANWVPEGQIITTNLWSAELSKLAANAFLAQRISSVNAMSALCESTGADVTQVSYAVGTDSRIGSKFLNASVGFGGSCFQKDILNLVYICQCNGLPEVAEYWKQVIKINDYQKNRFVNRIVSSMFNTVSNKKVAILGFAFKKDTGDTRETPAIDVCKGLLGDKAQISIYDPQVTEEQIQRDLSMKKFDWDHPLHLQPMSPTTVKQVSVTWDAYEATKDAHAVCVLTEWDEFKSLDYQKIFDNMQKPAFIFDGRNIMNVNKLREIGFIVYSIGKPLDPWLKDMPAFV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
305 | Phosphorylation | QVIKINDYQKNRFVN HHHCCCHHHHCHHHH | 24894044 | ||
316 | Phosphorylation | RFVNRIVSSMFNTVS HHHHHHHHHHHHCCC | 23328941 | ||
323 | Phosphorylation | SSMFNTVSNKKVAIL HHHHHCCCCCEEEEE | 23328941 | ||
393 | Phosphorylation | PLHLQPMSPTTVKQV CCEECCCCCCEEEEE | 30291188 | ||
395 | Phosphorylation | HLQPMSPTTVKQVSV EECCCCCCEEEEEEE | 24924143 | ||
396 | Phosphorylation | LQPMSPTTVKQVSVT ECCCCCCEEEEEEEE | 19880383 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of UGDH4_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UGDH4_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UGDH4_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of UGDH4_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...