UFD1_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: UFD1_MOUSE
• UniProt AC: P70362
• Protein Name: Ubiquitin recognition factor in ER-associated degradation protein 1
• Gene Name: Ufd1 {ECO:0000312|MGI:MGI:109353}
• Organism: Mus musculus (Mouse).
• Sequence Length: 307
• Subcellular Localization: Nucleus . Cytoplasm, cytosol .
• Protein Description: Essential component of the ubiquitin-dependent proteolytic pathway which degrades ubiquitin fusion proteins. The ternary complex containing UFD1, VCP and NPLOC4 binds ubiquitinated proteins and is necessary for the export of misfolded proteins from the ER to the cytoplasm, where they are degraded by the proteasome. The NPLOC4-UFD1-VCP complex regulates spindle disassembly at the end of mitosis and is necessary for the formation of a closed nuclear envelope. It may be involved in the development of some ectoderm-derived structures (By similarity). Acts as a negative regulator of type I interferon production via the complex formed with VCP and NPLOC4, which binds to DDX58/RIG-I and recruits RNF125 to promote ubiquitination and degradation of DDX58/RIG-I (By similarity)..
• Protein Sequence: MFSFNMFDHPIPRVFQNRFSTQYRCFSVSMLAGPNDRSDVEKGGKIIMPPSALDQLSRLNITYPMLFKLTNKNSDRMTHCGVLEFVADEGICYLPHWMMQNLLLEEGGLVQVESVNLQVATYSKFQPQSPDFLDITNPKAVLENALRNFACLTTGDVIAINYNEKIYELRVMETKPDKAVSIIECDMNVDFDAPLGYKEPERPVQHEESIEGEADHSGYAGEVGFRAFSGSGNRLDGKKKGVEPSPSPIKPGDIKRGIPNYEFKLGKITFIRNSRPLVKKVEEDEAGGRFIAFSGEGQSLRKKGRKP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
1	Acetylation	-------MFSFNMFD -------CCCCCCCC	5.99	-
3	Phosphorylation	-----MFSFNMFDHP -----CCCCCCCCCC	17.89	26745281
40	Ubiquitination	GPNDRSDVEKGGKII CCCCHHHHHCCCEEE	9.62	27667366
45	Ubiquitination	SDVEKGGKIIMPPSA HHHHCCCEEECCHHH	37.41	22790023
68	Ubiquitination	ITYPMLFKLTNKNSD CHHHHHEECCCCCCC	50.90	22790023
72	Ubiquitination	MLFKLTNKNSDRMTH HHEECCCCCCCCCCE	53.22	-
129	Phosphorylation	YSKFQPQSPDFLDIT EECCCCCCCCCCCCC	32.87	26824392
136	Phosphorylation	SPDFLDITNPKAVLE CCCCCCCCCHHHHHH	45.17	25293948
139	Ubiquitination	FLDITNPKAVLENAL CCCCCCHHHHHHHHH	53.87	22790023
207	Ubiquitination	PERPVQHEESIEGEA CCCCCCCCHHCCCCC	36.03	27667366
209	Phosphorylation	RPVQHEESIEGEADH CCCCCCHHCCCCCCC	23.97	29899451
221	Ubiquitination	ADHSGYAGEVGFRAF CCCCCCCCEEEEEEE	22.95	27667366
224	Ubiquitination	SGYAGEVGFRAFSGS CCCCCEEEEEEECCC	11.30	27667366
229	Phosphorylation	EVGFRAFSGSGNRLD EEEEEEECCCCCCCC	30.94	29472430
231	Phosphorylation	GFRAFSGSGNRLDGK EEEEECCCCCCCCCC	31.53	29514104
245	Phosphorylation	KKKGVEPSPSPIKPG CCCCCCCCCCCCCCC	25.22	26824392
245	Ubiquitination	KKKGVEPSPSPIKPG CCCCCCCCCCCCCCC	25.22	27667366
247	Phosphorylation	KGVEPSPSPIKPGDI CCCCCCCCCCCCCCC	43.53	26824392
250	Ubiquitination	EPSPSPIKPGDIKRG CCCCCCCCCCCCCCC	46.46	22790023
255	Ubiquitination	PIKPGDIKRGIPNYE CCCCCCCCCCCCCCE	49.68	-
259	Ubiquitination	GDIKRGIPNYEFKLG CCCCCCCCCCEEEEC	39.93	27667366
261	Phosphorylation	IKRGIPNYEFKLGKI CCCCCCCCEEEECCE	19.86	29514104
262	Ubiquitination	KRGIPNYEFKLGKIT CCCCCCCEEEECCEE	42.84	27667366
264	Ubiquitination	GIPNYEFKLGKITFI CCCCCEEEECCEEEE	44.37	22790023
264	Acetylation	GIPNYEFKLGKITFI CCCCCEEEECCEEEE	44.37	30988477
267	Ubiquitination	NYEFKLGKITFIRNS CCEEEECCEEEEECC	49.35	22790023
294	Phosphorylation	GGRFIAFSGEGQSLR CCEEEEECCCCCHHH	27.23	28833060
299	Phosphorylation	AFSGEGQSLRKKGRK EECCCCCHHHHCCCC	40.78	25521595

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of UFD1_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of UFD1_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of UFD1_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
UBC_HUMAN	UBC	physical	12411482
TERA_MOUSE	Vcp	physical	17491009
TERA_MOUSE	Vcp	physical	12529442

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.

Related Literatures of Post-Translational Modification

Phosphorylation

"Large-scale phosphorylation analysis of mouse liver.";
Villen J., Beausoleil S.A., Gerber S.A., Gygi S.P.;
Proc. Natl. Acad. Sci. U.S.A. 104:1488-1493(2007).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-247, AND MASSSPECTROMETRY.
PubMed: 17242355