| UniProt ID | UE2NL_HUMAN | |
|---|---|---|
| UniProt AC | Q5JXB2 | |
| Protein Name | Putative ubiquitin-conjugating enzyme E2 N-like | |
| Gene Name | UBE2NL | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 153 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MAELPHRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGESKDSPFEGGTFKRELLLAEEYPMAAPKVRFMTKIYHPNVDKLERISLDILKDKWSPALQIRTVLLSIQALLNAPNPDDPLANDVVEQWKTNEAQAIETARAWTRLYAMNSI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 10 | Acetylation | ELPHRIIKETQRLLA CCCHHHHHHHHHHHC | 52.95 | 30799487 | |
| 10 | Ubiquitination | ELPHRIIKETQRLLA CCCHHHHHHHHHHHC | 52.95 | 21906983 | |
| 24 | Ubiquitination | AEPVPGIKAEPDESN CCCCCCCCCCCCCCC | 53.24 | 23000965 | |
| 34 | Phosphorylation | PDESNARYFHVVIAG CCCCCCCEEEEEEEE | 8.81 | - | |
| 69 | Ubiquitination | EYPMAAPKVRFMTKI CCCCCCCCCEEEECC | 41.12 | 23000965 | |
| 75 | Ubiquitination | PKVRFMTKIYHPNVD CCCEEEECCCCCCHH | 29.49 | 23000965 | |
| 77 | Phosphorylation | VRFMTKIYHPNVDKL CEEEECCCCCCHHHH | 16.87 | 28152594 | |
| 83 | Acetylation | IYHPNVDKLERISLD CCCCCHHHHHHHCHH | 48.22 | - | |
| 88 | Phosphorylation | VDKLERISLDILKDK HHHHHHHCHHHHCCC | 26.64 | 28060719 | |
| 93 | Ubiquitination | RISLDILKDKWSPAL HHCHHHHCCCCCHHH | 58.56 | 23000965 | |
| 95 | Acetylation | SLDILKDKWSPALQI CHHHHCCCCCHHHHH | 48.24 | 30799479 | |
| 95 | Ubiquitination | SLDILKDKWSPALQI CHHHHCCCCCHHHHH | 48.24 | 23000965 | |
| 95 | Neddylation | SLDILKDKWSPALQI CHHHHCCCCCHHHHH | 48.24 | 32015554 | |
| 97 | Phosphorylation | DILKDKWSPALQIRT HHHCCCCCHHHHHHH | 13.16 | 28857561 | |
| 140 | Phosphorylation | NEAQAIETARAWTRL CHHHHHHHHHHHHHH | 18.48 | - | |
| 142 | Methylation | AQAIETARAWTRLYA HHHHHHHHHHHHHHH | 37.77 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of UE2NL_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UE2NL_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UE2NL_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of UE2NL_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "Improved titanium dioxide enrichment of phosphopeptides from HeLacells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra."; Yu L.-R., Zhu Z., Chan K.C., Issaq H.J., Dimitrov D.S., Veenstra T.D.; J. Proteome Res. 6:4150-4162(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-77, AND MASSSPECTROMETRY. | |
