dbPTM

UCRIA_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	UCRIA_ARATH
UniProt AC	Q9ZR03
Protein Name	Cytochrome b6-f complex iron-sulfur subunit, chloroplastic
Gene Name	petC
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	229
Subcellular Localization	Plastid, chloroplast thylakoid membrane Single-pass membrane protein. The transmembrane helix obliquely spans the membrane in one monomer, and its extrinsic C-terminal domain is part of the other monomer..
Protein Description	Essential protein for photoautotrophism. Confers resistance to photo-oxidative damages by contributing to the thermal dissipation of light energy and to lumenal acidification (increase of pH gradient). Component of the cytochrome b6-f complex, which mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions (By similarity)..
Protein Sequence	MASSSLSPATQLGSSRSALMAMSSGLFVKPTKMNHQMVRKEKIGLRISCQASSIPADRVPDMEKRKTLNLLLLGALSLPTGYMLVPYATFFVPPGTGGGGGGTPAKDALGNDVVAAEWLKTHGPGDRTLTQGLKGDPTYLVVENDKTLATYGINAVCTHLGCVVPWNKAENKFLCPCHGSQYNAQGRVVRGPAPLSLALAHADIDEAGKVLFVPWVETDFRTGDAPWWS

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
52	Phosphorylation	LRISCQASSIPADRV CEEEEECCCCCHHHC	11.70	29654922
139	Nitration	GLKGDPTYLVVENDK CCCCCCEEEEEECCC	11.68	-
180	Phosphorylation	FLCPCHGSQYNAQGR EECCCCCCCCCCCCC	13.06	22092075
196	Phosphorylation	VRGPAPLSLALAHAD EECCCCHHHHHHCCC	15.55	14593172

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of UCRIA_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of UCRIA_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of UCRIA_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of UCRIA_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of UCRIA_ARATH

Related Literatures of Post-Translational Modification