UniProt ID | UCP1_RAT | |
---|---|---|
UniProt AC | P04633 | |
Protein Name | Mitochondrial brown fat uncoupling protein 1 {ECO:0000305} | |
Gene Name | Ucp1 {ECO:0000312|RGD:3931} | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 307 | |
Subcellular Localization |
Mitochondrion inner membrane Multi-pass membrane protein . |
|
Protein Description | Mitochondrial protein responsible for thermogenic respiration, a specialized capacity of brown adipose tissue and beige fat that participates to non-shivering adaptive thermogenesis to temperature and diet variations and more generally to the regulation of energy balance (By similarity). Functions as a long-chain fatty acid/LCFA and proton symporter, simultaneously transporting one LCFA and one proton through the inner mitochondrial membrane. However, LCFAs remaining associated with the transporter via their hydrophobic tails, it results in an apparent transport of protons activated by LCFAs. [PubMed: 12479871] | |
Protein Sequence | MVSSTTSEVQPTMGVKIFSAGVSACLADIITFPLDTAKVRLQIQGEGQASSTIRYKGVLGTITTLAKTEGLPKLYSGLPAGIQRQISFASLRIGLYDTVQEYFSSGRETPASLGSKISAGLMTGGVAVFIGQPTEVVKVRMQAQSHLHGIKPRYTGTYNAYRVIATTESLSTLWKGTTPNLMRNVIINCTELVTYDLMKGALVNHHILADDVPCHLLSALVAGFCTTLLASPVDVVKTRFINSLPGQYPSVPSCAMTMYTKEGPAAFFKGFAPSFLRLGSWNVIMFVCFEQLKKELMKSRQTVDCTT | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
3 | Phosphorylation | -----MVSSTTSEVQ -----CCCCCCCCCC | 22.22 | 18486593 | |
4 | Phosphorylation | ----MVSSTTSEVQP ----CCCCCCCCCCC | 25.05 | 18486593 | |
51 | Phosphorylation | QGEGQASSTIRYKGV CCCCCCCCEEEEEEE | 30.76 | 22817900 | |
67 | Acetylation | GTITTLAKTEGLPKL HHHHHHHHHCCCCHH | 50.66 | 22902405 | |
73 | Acetylation | AKTEGLPKLYSGLPA HHHCCCCHHHCCCCH | 66.16 | 22902405 | |
151 | Acetylation | QSHLHGIKPRYTGTY HHHHCCCCCCCCCCC | 28.21 | 22902405 | |
254 | Cysteine sulfenic acid (-SOH) | QYPSVPSCAMTMYTK CCCCCCCEEEEEEEC | 2.16 | - | |
254 | Oxidation | QYPSVPSCAMTMYTK CCCCCCCEEEEEEEC | 2.16 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of UCP1_RAT !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UCP1_RAT !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UCP1_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...