UCMA_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: UCMA_HUMAN
• UniProt AC: Q8WVF2
• Protein Name: Unique cartilage matrix-associated protein
• Gene Name: UCMA
• Organism: Homo sapiens (Human).
• Sequence Length: 138
• Subcellular Localization: Secreted, extracellular space, extracellular matrix.
• Protein Description: May be involved in the negative control of osteogenic differentiation of osteochondrogenic precursor cells in peripheral zones of fetal cartilage and at the cartilage-bone interface..
• Protein Sequence: MTWRQAVLLSCFSAVVLLSMLREGTSVSVGTMQMAGEEASEDAKQKIFMQESDASNFLKRRGKRSPKSRDEVNVENRQKLRVDELRREYYEEQRNEFENFVEEQNDEQEERSREAVEQWRQWHYDGLHPSYLYNRHHT

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MTWRQAVLL ------CCHHHHHHH	29.38	24043423
10	Phosphorylation	WRQAVLLSCFSAVVL HHHHHHHHHHHHHHH	14.68	24043423
13	Phosphorylation	AVLLSCFSAVVLLSM HHHHHHHHHHHHHHH	25.20	24043423
19	Phosphorylation	FSAVVLLSMLREGTS HHHHHHHHHHHCCCC	16.17	24043423

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of UCMA_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of UCMA_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of UCMA_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of UCMA_HUMAN !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.