| UniProt ID | UCMA_HUMAN | |
|---|---|---|
| UniProt AC | Q8WVF2 | |
| Protein Name | Unique cartilage matrix-associated protein | |
| Gene Name | UCMA | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 138 | |
| Subcellular Localization | Secreted, extracellular space, extracellular matrix. | |
| Protein Description | May be involved in the negative control of osteogenic differentiation of osteochondrogenic precursor cells in peripheral zones of fetal cartilage and at the cartilage-bone interface.. | |
| Protein Sequence | MTWRQAVLLSCFSAVVLLSMLREGTSVSVGTMQMAGEEASEDAKQKIFMQESDASNFLKRRGKRSPKSRDEVNVENRQKLRVDELRREYYEEQRNEFENFVEEQNDEQEERSREAVEQWRQWHYDGLHPSYLYNRHHT | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MTWRQAVLL ------CCHHHHHHH | 29.38 | 24043423 | |
| 10 | Phosphorylation | WRQAVLLSCFSAVVL HHHHHHHHHHHHHHH | 14.68 | 24043423 | |
| 13 | Phosphorylation | AVLLSCFSAVVLLSM HHHHHHHHHHHHHHH | 25.20 | 24043423 | |
| 19 | Phosphorylation | FSAVVLLSMLREGTS HHHHHHHHHHHCCCC | 16.17 | 24043423 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of UCMA_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UCMA_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UCMA_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of UCMA_HUMAN !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...