UniProt ID | UCHL4_MOUSE | |
---|---|---|
UniProt AC | P58321 | |
Protein Name | Ubiquitin carboxyl-terminal hydrolase isozyme L4 | |
Gene Name | Uchl4 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 233 | |
Subcellular Localization | Cytoplasm. | |
Protein Description | Ubiquitin-protein hydrolase is involved both in the processing of ubiquitin precursors and of ubiquitinated proteins. This enzyme is a thiol protease that recognizes and hydrolyzes a peptide bond at the C-terminal glycine of ubiquitin.. | |
Protein Sequence | MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMESELLSIIPRPVCAVLLLFPITEKYEVFRTEEEEKIKSQGQDVTSSVYFMKQTISNACGTIGTIGLIHAIANNKDKVHFESGSTLKKFLEESVSMSPEERAKYLENYDAIRVTHETSAHEGQTEAPSIDEKVDLHFIALVHVDGHLYELDGWKPFPINHGKTSDETLLEDVIKVCKKFMERDPDELRFNAIALSAA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
61 | Ubiquitination | LLFPITEKYEVFRTE HHEECCCCEEECCCH | 37.75 | - | |
74 | Ubiquitination | TEEEEKIKSQGQDVT CHHHHHHHHCCCCCH | 48.04 | - | |
124 | Acetylation | ESGSTLKKFLEESVS CCCHHHHHHHHHHHC | 59.29 | 22826441 | |
124 | Ubiquitination | ESGSTLKKFLEESVS CCCHHHHHHHHHHHC | 59.29 | - | |
129 | Phosphorylation | LKKFLEESVSMSPEE HHHHHHHHHCCCHHH | 15.32 | 26239621 | |
131 | Phosphorylation | KFLEESVSMSPEERA HHHHHHHCCCHHHHH | 23.87 | 26239621 | |
133 | Phosphorylation | LEESVSMSPEERAKY HHHHHCCCHHHHHHH | 22.96 | 27742792 | |
164 | Phosphorylation | EGQTEAPSIDEKVDL CCCCCCCCCCCCCCE | 50.12 | 26824392 | |
168 | Ubiquitination | EAPSIDEKVDLHFIA CCCCCCCCCCEEEEE | 36.98 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of UCHL4_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UCHL4_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UCHL4_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of UCHL4_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Protein phosphorylation and expression profiling by Yin-yangmultidimensional liquid chromatography (Yin-yang MDLC) massspectrometry."; Dai J., Jin W.-H., Sheng Q.-H., Shieh C.-H., Wu J.-R., Zeng R.; J. Proteome Res. 6:250-262(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-133, AND MASSSPECTROMETRY. |