| UniProt ID | UBP12_MOUSE | |
|---|---|---|
| UniProt AC | Q9D9M2 | |
| Protein Name | Ubiquitin carboxyl-terminal hydrolase 12 | |
| Gene Name | Usp12 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 370 | |
| Subcellular Localization | ||
| Protein Description | Deubiquitinating enzyme. Has almost no deubiquitinating activity by itself and requires the interaction with WDR48 to have a high activity. Not involved in deubiquitination of monoubiquitinated FANCD2.. | |
| Protein Sequence | MEILMTVSKFASICTMGANASALEKEIGPEQFPVNEHYFGLVNFGNTCYCNSVLQALYFCRPFREKVLAYKSQPRKKENLLTCLADLFHSIATQKKKVGVIPPKKFITRLRKENELFDNYMQQDAHEFLNYLLNTIADILQEERKQEKQNGRLRNGDVDNEDNNSTPDPTWVHEIFQGTLTNETRCLTCETISSKDEDFLDLSVDVEQNTSITHCLRGFSNTETLCSEYKYYCEECRSKQEAHKRMKVKKLPLILALHLKRFKYMDQLHRYTKLSYRVVFPLELRLFNTSGDATNPDRMYDLVAVVVHCGSGPNRGHYIAIVKSHDFWLLFDDDIVEKIDAQAIEEFYGLTSDISKNSESGYILFYQSRD | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 14 | S-palmitoylation | VSKFASICTMGANAS HHHHHHHHHHCCCHH | 1.66 | 28680068 | |
| 82 | Phosphorylation | RKKENLLTCLADLFH CHHHCHHHHHHHHHH | 14.51 | 28973931 | |
| 93 | Phosphorylation | DLFHSIATQKKKVGV HHHHHHHHCCCCCCC | 38.97 | 28973931 | |
| 153 | Ubiquitination | QEKQNGRLRNGDVDN HHHHCCCCCCCCCCC | 5.45 | 27667366 | |
| 273 | Ubiquitination | DQLHRYTKLSYRVVF HHHHHHHCCCEEEEE | 26.88 | 27667366 | |
| 360 | Phosphorylation | DISKNSESGYILFYQ CCCCCCCCCEEEEEE | 36.40 | 27742792 | |
| 362 | Phosphorylation | SKNSESGYILFYQSR CCCCCCCEEEEEEEC | 12.06 | 27742792 | |
| 366 | Phosphorylation | ESGYILFYQSRD--- CCCEEEEEEECC--- | 11.35 | 27742792 | |
| 368 | Phosphorylation | GYILFYQSRD----- CEEEEEEECC----- | 27.34 | 27742792 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of UBP12_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UBP12_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UBP12_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of UBP12_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
