dbPTM

UBIA1_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	UBIA1_DROME
UniProt AC	Q9V3R8
Protein Name	UbiA prenyltransferase domain-containing protein 1 homolog
Gene Name	heix
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	359
Subcellular Localization	Mitochondrion membrane Multi-pass membrane protein .
Protein Description	Prenyltransferase that mediates the formation of menaquinone-4 (MK-4), a vitamin K2 isoform, thereby acting as a mitochondrial electron carrier. Mediates the conversion of phylloquinone (PK) into MK-4, probably by cleaving the side chain of phylloquinone (PK) to release 2-methyl-1,4-naphthoquinone (menadione; K3) and then prenylating it with geranylgeranyl pyrophosphate (GGPP) to form MK-4. MK-4 acts as a membrane electron carrier downstream of a electron transport chain complex, improving mitochondrial oxygen consumption..
Protein Sequence	MATSSQLLPNGNLSRNGKTKTEDGEEVEAVVGARAAGADAGVALTGRLTGHPSTSGTFMKLKTYLLALRPWSLSASLVPTLLGSALAYRSQWAEEFSLATFFLTAFTVVTVHCAGNVVNTYFDFIKGIDKQKADDRTLVDHILTKDEVVSLGAILYMAGCGGFVLLAVLSPAKMEHLALIYFGGLSSSFLYTGGIGFKYIALGDLVILILFGPISVLFAFMSQTGHLDWTTMGYAIPLALNTEAILHSNNTRDADNDRRAGIVTLAILIGRTASHVLYAMLLFAPYSLFFIFGLKYSLWFLLPLVTLPQAFQIEKRFRNEQTMHLVPRQTAKLNFFFGILYVVACCCAHQLPTFGLRRN

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of UBIA1_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of UBIA1_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of UBIA1_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of UBIA1_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
KRH2_DROME	Kr-h2	physical	22036573

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of UBIA1_DROME

Related Literatures of Post-Translational Modification