UniProt ID | UBFD1_MOUSE | |
---|---|---|
UniProt AC | Q78JW9 | |
Protein Name | Ubiquitin domain-containing protein UBFD1 | |
Gene Name | Ubfd1 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 368 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MLKRGRGRPGKRRRRVSIETSTCFRPACVKLGAGAGANLRQLASSRRPLRSWWVLYTIIMAAAGAPDGMEEPGMDTEAEAVATEAPARPLNCVEAEAAVGAAAEDSCDARGNLQPAPAQPPGDPAAQASVSNGEDAGGGVGKELVDLKIIWNKTKHDVKVPLDSTGSELKQKIHSITGLPPAMQKVMYKGLVPEDKTLREIKVTSGAKIMVVGSTINDVLAVNTPKDAAQQDAKAEENKKEPLCRQKQHRKVLDKGKPEDVMPSVKGAQERLPTVPLSGMYNKSGGKVRLTFKLEQDQLWIGTKERTEKLPMGSIKNVVSEPIEGHEDYHMMAFQLGPTEASYYWVYWVPTQYVDAIKDTVLGKWQYF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
129 | Phosphorylation | GDPAAQASVSNGEDA CCHHHHHHHCCCCCC | 17.63 | 29899451 | |
131 | Phosphorylation | PAAQASVSNGEDAGG HHHHHHHCCCCCCCC | 36.30 | 19060867 | |
153 | Ubiquitination | DLKIIWNKTKHDVKV EEEEEECCCCCCEEC | 43.91 | 22790023 | |
159 | Ubiquitination | NKTKHDVKVPLDSTG CCCCCCEECCCCCCC | 44.16 | 22790023 | |
170 | Ubiquitination | DSTGSELKQKIHSIT CCCCHHHHHHHHHHH | 45.56 | 22790023 | |
185 | Ubiquitination | GLPPAMQKVMYKGLV CCCHHHHHHHHCCCC | 18.84 | 22790023 | |
196 | Ubiquitination | KGLVPEDKTLREIKV CCCCCCCCCHHEEEE | 48.04 | 27667366 | |
197 | Phosphorylation | GLVPEDKTLREIKVT CCCCCCCCHHEEEEC | 43.29 | 28059163 | |
208 | Ubiquitination | IKVTSGAKIMVVGST EEECCCCEEEEEECC | 34.56 | 22790023 | |
226 | Ubiquitination | VLAVNTPKDAAQQDA HHCCCCCHHHHHHHH | 58.94 | - | |
234 | Ubiquitination | DAAQQDAKAEENKKE HHHHHHHHHHHHCCC | 65.70 | - | |
274 | Phosphorylation | GAQERLPTVPLSGMY CHHHHCCCCCCCEEE | 39.07 | - | |
283 | Ubiquitination | PLSGMYNKSGGKVRL CCCEEEECCCCEEEE | 32.75 | 22790023 | |
304 | Ubiquitination | DQLWIGTKERTEKLP CEEEEEECCCCCCCC | 39.73 | 22790023 | |
364 | Ubiquitination | IKDTVLGKWQYF--- HHHHHCCCCCCC--- | 27.28 | 27667366 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of UBFD1_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UBFD1_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UBFD1_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of UBFD1_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...