| UniProt ID | UBFD1_MOUSE | |
|---|---|---|
| UniProt AC | Q78JW9 | |
| Protein Name | Ubiquitin domain-containing protein UBFD1 | |
| Gene Name | Ubfd1 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 368 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MLKRGRGRPGKRRRRVSIETSTCFRPACVKLGAGAGANLRQLASSRRPLRSWWVLYTIIMAAAGAPDGMEEPGMDTEAEAVATEAPARPLNCVEAEAAVGAAAEDSCDARGNLQPAPAQPPGDPAAQASVSNGEDAGGGVGKELVDLKIIWNKTKHDVKVPLDSTGSELKQKIHSITGLPPAMQKVMYKGLVPEDKTLREIKVTSGAKIMVVGSTINDVLAVNTPKDAAQQDAKAEENKKEPLCRQKQHRKVLDKGKPEDVMPSVKGAQERLPTVPLSGMYNKSGGKVRLTFKLEQDQLWIGTKERTEKLPMGSIKNVVSEPIEGHEDYHMMAFQLGPTEASYYWVYWVPTQYVDAIKDTVLGKWQYF | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 129 | Phosphorylation | GDPAAQASVSNGEDA CCHHHHHHHCCCCCC | 17.63 | 29899451 | |
| 131 | Phosphorylation | PAAQASVSNGEDAGG HHHHHHHCCCCCCCC | 36.30 | 19060867 | |
| 153 | Ubiquitination | DLKIIWNKTKHDVKV EEEEEECCCCCCEEC | 43.91 | 22790023 | |
| 159 | Ubiquitination | NKTKHDVKVPLDSTG CCCCCCEECCCCCCC | 44.16 | 22790023 | |
| 170 | Ubiquitination | DSTGSELKQKIHSIT CCCCHHHHHHHHHHH | 45.56 | 22790023 | |
| 185 | Ubiquitination | GLPPAMQKVMYKGLV CCCHHHHHHHHCCCC | 18.84 | 22790023 | |
| 196 | Ubiquitination | KGLVPEDKTLREIKV CCCCCCCCCHHEEEE | 48.04 | 27667366 | |
| 197 | Phosphorylation | GLVPEDKTLREIKVT CCCCCCCCHHEEEEC | 43.29 | 28059163 | |
| 208 | Ubiquitination | IKVTSGAKIMVVGST EEECCCCEEEEEECC | 34.56 | 22790023 | |
| 226 | Ubiquitination | VLAVNTPKDAAQQDA HHCCCCCHHHHHHHH | 58.94 | - | |
| 234 | Ubiquitination | DAAQQDAKAEENKKE HHHHHHHHHHHHCCC | 65.70 | - | |
| 274 | Phosphorylation | GAQERLPTVPLSGMY CHHHHCCCCCCCEEE | 39.07 | - | |
| 283 | Ubiquitination | PLSGMYNKSGGKVRL CCCEEEECCCCEEEE | 32.75 | 22790023 | |
| 304 | Ubiquitination | DQLWIGTKERTEKLP CEEEEEECCCCCCCC | 39.73 | 22790023 | |
| 364 | Ubiquitination | IKDTVLGKWQYF--- HHHHHCCCCCCC--- | 27.28 | 27667366 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of UBFD1_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UBFD1_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UBFD1_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of UBFD1_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...