| UniProt ID | UBE2Z_MOUSE | |
|---|---|---|
| UniProt AC | Q3UE37 | |
| Protein Name | Ubiquitin-conjugating enzyme E2 Z | |
| Gene Name | Ube2z | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 356 | |
| Subcellular Localization | Cytoplasm . Nucleus . | |
| Protein Description | Catalyzes the covalent attachment of ubiquitin to other proteins. Specific substrate for UBA6, not charged with ubiquitin by UBE1. May be involved in apoptosis regulation.. | |
| Protein Sequence | MAESPTEEAATATAGAGAAGPGSSGVAGVVGVSGSGGGFGPPFLPDVWAAAAAAGGAGGPGSGLAPLPGLPPSAAAHGAALLSHWDPTLSSDWDGERTAPQCLLRIKRDIMSIYKEPPPGMFVVPDTVDMTKIHALITGPFDTPYEGGFFLFVFRCPPDYPIHPPRVKLMTTGNNTVRFNPNFYRNGKVCLSILGTWTGPAWSPAQSISSVLISIQSLMTENPYHNEPGFEQERHPGDSKNYNECIRHETIRVAVCDMMEGKCPCPEPLRGVMEKSFLEYYDFYEVACKDRLHLQGQTMQDPFGEKRGHFDYQSLLMRLGLIRQKVLERLHNENAEMDSDSSSSGTETDLHGSLRV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 168 | Ubiquitination | PIHPPRVKLMTTGNN CCCCCCEEEEECCCC | 33.54 | 22790023 | |
| 172 | Phosphorylation | PRVKLMTTGNNTVRF CCEEEEECCCCEEEC | 24.77 | 26026062 | |
| 339 | Phosphorylation | NENAEMDSDSSSSGT HCCCCCCCCCCCCCC | 37.77 | 21082442 | |
| 341 | Phosphorylation | NAEMDSDSSSSGTET CCCCCCCCCCCCCCC | 35.75 | 21183079 | |
| 342 | Phosphorylation | AEMDSDSSSSGTETD CCCCCCCCCCCCCCC | 33.25 | 27087446 | |
| 343 | Phosphorylation | EMDSDSSSSGTETDL CCCCCCCCCCCCCCC | 36.42 | 27087446 | |
| 344 | Phosphorylation | MDSDSSSSGTETDLH CCCCCCCCCCCCCCC | 52.24 | 27087446 | |
| 346 | Phosphorylation | SDSSSSGTETDLHGS CCCCCCCCCCCCCCC | 37.35 | 27087446 | |
| 348 | Phosphorylation | SSSSGTETDLHGSLR CCCCCCCCCCCCCCC | 43.64 | 30635358 | |
| 353 | Phosphorylation | TETDLHGSLRV---- CCCCCCCCCCC---- | 11.40 | 30635358 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of UBE2Z_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UBE2Z_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UBE2Z_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of UBE2Z_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "Solid tumor proteome and phosphoproteome analysis by high resolutionmass spectrometry."; Zanivan S., Gnad F., Wickstroem S.A., Geiger T., Macek B., Cox J.,Faessler R., Mann M.; J. Proteome Res. 7:5314-5326(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-339, AND MASSSPECTROMETRY. | |
