UniProt ID | UBAC2_MOUSE | |
---|---|---|
UniProt AC | Q8R1K1 | |
Protein Name | Ubiquitin-associated domain-containing protein 2 | |
Gene Name | Ubac2 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 345 | |
Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein . |
|
Protein Description | Restricts trafficking of FAF2 from the endoplasmic reticulum to lipid droplets.. | |
Protein Sequence | MFTSTGSSGLYKAPLSKSLLLVPSALSLLLTLLLPHCQKFFVYDLHAVKHDLQIWRLICGRIICLDLKDAFCSGLLIYNFRIFERRYGSRKFASFLLGSWVLSALFDFILVEAVQYSLGVTVASNLPSGFLAPVFALFVPFHCSIPRVQVAQILGPLSITNKTLIYILGLQLFTSGSYIWIVAMSGLISGMCYDRKVLQVHQVLRIPGRMAEFFSWALEPIFSSSEPTSEARVGMGATVDIQRQQRMEQLDRQLMLSQFAQVRRQRQQQGGMINWNRLFPPLRQRRNINYQDGPRSEQRASPPLEVSEEQVARLMEMGFSRGDALEALRASNNDLNVATNFLLQH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
5 | Phosphorylation | ---MFTSTGSSGLYK ---CCCCCCCCCCCC | 37.72 | 28576409 | |
161 | N-linked_Glycosylation | LGPLSITNKTLIYIL HCCHHCCCCHHHHHH | 33.38 | - | |
296 | Phosphorylation | NYQDGPRSEQRASPP CCCCCCCCCCCCCCC | 41.01 | 25293948 | |
301 | Phosphorylation | PRSEQRASPPLEVSE CCCCCCCCCCCCCCH | 29.28 | 27566939 | |
307 | Phosphorylation | ASPPLEVSEEQVARL CCCCCCCCHHHHHHH | 26.49 | 26643407 | |
320 | Phosphorylation | RLMEMGFSRGDALEA HHHHCCCCHHHHHHH | 29.62 | 26643407 | |
331 | Phosphorylation | ALEALRASNNDLNVA HHHHHHHCCCCCCHH | 29.72 | 22871156 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of UBAC2_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UBAC2_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UBAC2_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of UBAC2_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...