dbPTM

UBAC2_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	UBAC2_MOUSE
UniProt AC	Q8R1K1
Protein Name	Ubiquitin-associated domain-containing protein 2
Gene Name	Ubac2
Organism	Mus musculus (Mouse).
Sequence Length	345
Subcellular Localization	Endoplasmic reticulum membrane Multi-pass membrane protein .
Protein Description	Restricts trafficking of FAF2 from the endoplasmic reticulum to lipid droplets..
Protein Sequence	MFTSTGSSGLYKAPLSKSLLLVPSALSLLLTLLLPHCQKFFVYDLHAVKHDLQIWRLICGRIICLDLKDAFCSGLLIYNFRIFERRYGSRKFASFLLGSWVLSALFDFILVEAVQYSLGVTVASNLPSGFLAPVFALFVPFHCSIPRVQVAQILGPLSITNKTLIYILGLQLFTSGSYIWIVAMSGLISGMCYDRKVLQVHQVLRIPGRMAEFFSWALEPIFSSSEPTSEARVGMGATVDIQRQQRMEQLDRQLMLSQFAQVRRQRQQQGGMINWNRLFPPLRQRRNINYQDGPRSEQRASPPLEVSEEQVARLMEMGFSRGDALEALRASNNDLNVATNFLLQH

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
5	Phosphorylation	---MFTSTGSSGLYK ---CCCCCCCCCCCC	37.72	28576409
161	N-linked_Glycosylation	LGPLSITNKTLIYIL HCCHHCCCCHHHHHH	33.38	-
296	Phosphorylation	NYQDGPRSEQRASPP CCCCCCCCCCCCCCC	41.01	25293948
301	Phosphorylation	PRSEQRASPPLEVSE CCCCCCCCCCCCCCH	29.28	27566939
307	Phosphorylation	ASPPLEVSEEQVARL CCCCCCCCHHHHHHH	26.49	26643407
320	Phosphorylation	RLMEMGFSRGDALEA HHHHCCCCHHHHHHH	29.62	26643407
331	Phosphorylation	ALEALRASNNDLNVA HHHHHHHCCCCCCHH	29.72	22871156

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of UBAC2_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of UBAC2_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of UBAC2_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of UBAC2_MOUSE !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of UBAC2_MOUSE

Related Literatures of Post-Translational Modification