UB2V2_DANRE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: UB2V2_DANRE
• UniProt AC: Q6PEH5
• Protein Name: Ubiquitin-conjugating enzyme E2 variant 2
• Gene Name: ube2v2
• Organism: Danio rerio (Zebrafish) (Brachydanio rerio).
• Sequence Length: 145
• Protein Description: Has no ubiquitin ligase activity on its own. The ube2v2/ube2n heterodimer catalyzes the synthesis of non-canonical poly-ubiquitin chains that are linked through 'Lys-63'. This type of poly-ubiquitination does not lead to protein degradation by the proteasome. Mediates transcriptional activation of target genes. Plays a role in the control of progress through the cell cycle and differentiation. Plays a role in the error-free DNA repair pathway and contributes to the survival of cells after DNA damage (By similarity)..
• Protein Sequence: MAASSGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPARTNYENRIYSLKVECGPKYPEVPPTVRFVTKISMNGINNSNGMVDARSIPILAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTYSN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of UB2V2_DANRE !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of UB2V2_DANRE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of UB2V2_DANRE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of UB2V2_DANRE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.