UniProt ID | UB2R2_MOUSE | |
---|---|---|
UniProt AC | Q6ZWZ2 | |
Protein Name | Ubiquitin-conjugating enzyme E2 R2 | |
Gene Name | Ube2r2 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 238 | |
Subcellular Localization | ||
Protein Description | Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes monoubiquitination and 'Lys-48'-linked polyubiquitination. May be involved in degradation of katenin.. | |
Protein Sequence | MAQQQMTSSQKALMLELKSLQEEPVEGFRITLVDESDLYNWEVAIFGPPNTLYEGGYFKAHIKFPIDYPYSPPTFRFLTKMWHPNIYENGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTFSPANVDASVMFRKWRDSKGKDKEYAEIIRKQVSATKAEAEKDGVKVPTTLAEYCIKTKVPSNDNSSDLLYDDLYDDDIDDEDEEEEDADCYDDDDSGNEES | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
63 | Ubiquitination | GYFKAHIKFPIDYPY CEEEEEEECCCCCCC | 34.91 | 22790023 | |
93 | Glutathionylation | IYENGDVCISILHPP CCCCCCEEEEEECCC | 2.10 | 24333276 | |
228 | Phosphorylation | EEEDADCYDDDDSGN HHHCCCCCCCCCCCC | 23.97 | 29899451 | |
233 | Phosphorylation | DCYDDDDSGNEES-- CCCCCCCCCCCCC-- | 50.98 | 29899451 | |
238 | Phosphorylation | DDSGNEES------- CCCCCCCC------- | 39.07 | 24453211 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
233 | S | Phosphorylation | Kinase | CK2 | - | Uniprot |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UB2R2_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UB2R2_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of UB2R2_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...