UB2D1_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: UB2D1_MOUSE
• UniProt AC: P61080
• Protein Name: Ubiquitin-conjugating enzyme E2 D1
• Gene Name: Ube2d1
• Organism: Mus musculus (Mouse).
• Sequence Length: 147
• Subcellular Localization: Cytoplasm .
• Protein Description: Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-48'-linked polyubiquitination. Mediates the selective degradation of short-lived and abnormal proteins. Functions in the E6/E6-AP-induced ubiquitination of p53/TP53. Mediates ubiquitination of PEX5 and auto-ubiquitination of STUB1, TRAF6 and TRIM63/MURF1. Ubiquitinates STUB1-associated HSP90AB1 in vitro. Lacks inherent specificity for any particular lysine residue of ubiquitin. Essential for viral activation of IRF3. Mediates polyubiquitination of CYP3A4..
• Protein Sequence: MALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHAREWTQKYAM

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
8	Ubiquitination	MALKRIQKELSDLQR CHHHHHHHHHHHHHH	59.25	22790023
80	Phosphorylation	IYHPNINSNGSICLD ECCCCCCCCCEEHHH	38.48	23984901
83	Phosphorylation	PNINSNGSICLDILR CCCCCCCEEHHHHHH	17.87	26745281
85	S-nitrosocysteine	INSNGSICLDILRSQ CCCCCEEHHHHHHHC	2.75	-
85	Glutathionylation	INSNGSICLDILRSQ CCCCCEEHHHHHHHC	2.75	24333276
85	S-nitrosylation	INSNGSICLDILRSQ CCCCCEEHHHHHHHC	2.75	22178444
91	Phosphorylation	ICLDILRSQWSPALT EHHHHHHHCCCCCHH	32.34	-
144	Ubiquitination	HAREWTQKYAM---- HHHHHHHHHCC----	27.83	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of UB2D1_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of UB2D1_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of UB2D1_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of UB2D1_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.