| UniProt ID | UB2D1_MOUSE | |
|---|---|---|
| UniProt AC | P61080 | |
| Protein Name | Ubiquitin-conjugating enzyme E2 D1 | |
| Gene Name | Ube2d1 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 147 | |
| Subcellular Localization | Cytoplasm . | |
| Protein Description | Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-48'-linked polyubiquitination. Mediates the selective degradation of short-lived and abnormal proteins. Functions in the E6/E6-AP-induced ubiquitination of p53/TP53. Mediates ubiquitination of PEX5 and auto-ubiquitination of STUB1, TRAF6 and TRIM63/MURF1. Ubiquitinates STUB1-associated HSP90AB1 in vitro. Lacks inherent specificity for any particular lysine residue of ubiquitin. Essential for viral activation of IRF3. Mediates polyubiquitination of CYP3A4.. | |
| Protein Sequence | MALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHAREWTQKYAM | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 8 | Ubiquitination | MALKRIQKELSDLQR CHHHHHHHHHHHHHH | 59.25 | 22790023 | |
| 80 | Phosphorylation | IYHPNINSNGSICLD ECCCCCCCCCEEHHH | 38.48 | 23984901 | |
| 83 | Phosphorylation | PNINSNGSICLDILR CCCCCCCEEHHHHHH | 17.87 | 26745281 | |
| 85 | S-nitrosocysteine | INSNGSICLDILRSQ CCCCCEEHHHHHHHC | 2.75 | - | |
| 85 | Glutathionylation | INSNGSICLDILRSQ CCCCCEEHHHHHHHC | 2.75 | 24333276 | |
| 85 | S-nitrosylation | INSNGSICLDILRSQ CCCCCEEHHHHHHHC | 2.75 | 22178444 | |
| 91 | Phosphorylation | ICLDILRSQWSPALT EHHHHHHHCCCCCHH | 32.34 | - | |
| 144 | Ubiquitination | HAREWTQKYAM---- HHHHHHHHHCC---- | 27.83 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of UB2D1_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UB2D1_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UB2D1_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of UB2D1_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...