dbPTM

TYW3_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	TYW3_SCHPO
UniProt AC	Q9UTA5
Protein Name	tRNA wybutosine-synthesizing protein 3
Gene Name	tyw3
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	237
Subcellular Localization
Protein Description	S-adenosyl-L-methionine-dependent methyltransferase that acts as a component of the wybutosine biosynthesis pathway. Wybutosine is a hyper modified guanosine with a tricyclic base found at the 3'-position adjacent to the anticodon of eukaryotic phenylalanine tRNA. Probably methylates N-4 position of wybutosine-86 to produce wybutosine-72 (By similarity)..
Protein Sequence	MNIKGIDVSFDAQKKEILEGLKSSVPDASPKGHPDSPIFPLLDVINSHPDWVTTSSCSGRISVYVQGANSRKGGGYWLFVSHQAHEELPPVLEDEKVEYGKVPSSPVEGNREIQYAFEPMILHVQTRSLANAQHLQRVAASCGFRETGIQGSEQKFIVAIRTSLRMDIPIGCLTASEKLQFYITREYMCFLFKRSVEYFTENGNRMARLKEQLERQVEKRMKPRRKLRNMDDYLVQS

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
104	Phosphorylation	VEYGKVPSSPVEGNR CCCCCCCCCCCCCCC	50.70	29996109
105	Phosphorylation	EYGKVPSSPVEGNRE CCCCCCCCCCCCCCE	27.22	29996109

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of TYW3_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of TYW3_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of TYW3_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of TYW3_SCHPO !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of TYW3_SCHPO

Related Literatures of Post-Translational Modification