TYSY_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TYSY_MOUSE
• UniProt AC: P07607
• Protein Name: Thymidylate synthase
• Gene Name: Tyms
• Organism: Mus musculus (Mouse).
• Sequence Length: 307
• Subcellular Localization: Nucleus. Cytoplasm. Mitochondrion. Mitochondrion matrix. Mitochondrion inner membrane.
• Protein Description: Contributes to the de novo mitochondrial thymidylate biosynthesis pathway..
• Protein Sequence: MLVVGSELQSDAQQLSAEAPRHGELQYLRQVEHILRCGFKKEDRTGTGTLSVFGMQARYSLRDEFPLLTTKRVFWKGVLEELLWFIKGSTNAKELSSKGVRIWDANGSRDFLDSLGFSARQEGDLGPVYGFQWRHFGAEYKDMDSDYSGQGVDQLQKVIDTIKTNPDDRRIIMCAWNPKDLPLMALPPCHALCQFYVVNGELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLQPGDFVHTLGDAHIYLNHIEPLKIQLQREPRPFPKLKILRKVETIDDFKVEDFQIEGYNPHPTIKMEMAV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
60	Phosphorylation	FGMQARYSLRDEFPL EEEEECEECCCCCCC	16.04	26370283
108	Phosphorylation	RIWDANGSRDFLDSL EEEECCCCHHHHHHH	28.60	26745281
114	Phosphorylation	GSRDFLDSLGFSARQ CCHHHHHHHCCCCCC	32.32	23984901

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TYSY_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TYSY_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TYSY_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of TYSY_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.