UniProt ID | TXTP_MOUSE | |
---|---|---|
UniProt AC | Q8JZU2 | |
Protein Name | Tricarboxylate transport protein, mitochondrial {ECO:0000250|UniProtKB:P53007} | |
Gene Name | Slc25a1 {ECO:0000312|MGI:MGI:1345283} | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 311 | |
Subcellular Localization |
Mitochondrion inner membrane Multi-pass membrane protein . |
|
Protein Description | Involved in citrate-H(+)/malate exchange. Important for the bioenergetics of hepatic cells as it provides a carbon source for fatty acid and sterol biosyntheses, and NAD(+) for the glycolytic pathway.. | |
Protein Sequence | MAAPRGPRALSAAAPGSGKPKLTHPGKAILAGGLAGGIEICITFPTEYVKTQLQLDERANPPRYRGIGDCVRQTVRSHGVLGLYRGLSSLLYGSIPKAAVRFGMFEFLSNHMRDAQGRLDSRRGLLCGLGAGVAEAVVVVCPMETIKVKFIHDQTSSNPKYRGFFHGVREIIREQGLKGTYQGLTATVLKQGSNQAIRFFVMTSLRNWYQGDNHNKPMNPLITGVFGATAGAASVFGNTPLDVIKTRMQGLEAHKYRNTLDCGLKILKNEGPKAFYKGTVPRLGRVCLDVAIVFIIYDEVVKLLNKVWKTD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
11 | Phosphorylation | PRGPRALSAAAPGSG CCCCCCCCCCCCCCC | 26060331 | ||
70 | S-palmitoylation | RYRGIGDCVRQTVRS CCCCHHHHHHHHHHH | 26165157 | ||
77 | Phosphorylation | CVRQTVRSHGVLGLY HHHHHHHHCCHHHHH | - | ||
97 | Acetylation | LLYGSIPKAAVRFGM HHHCCCCHHHHHHHH | 23864654 | ||
97 | Malonylation | LLYGSIPKAAVRFGM HHHCCCCHHHHHHHH | 25418362 | ||
145 | Phosphorylation | VVVCPMETIKVKFIH EEECCCCEEEEEEEE | 29899451 | ||
149 | Acetylation | PMETIKVKFIHDQTS CCCEEEEEEEECCCC | 23201123 | ||
155 | Phosphorylation | VKFIHDQTSSNPKYR EEEEECCCCCCHHHC | 23684622 | ||
156 | Phosphorylation | KFIHDQTSSNPKYRG EEEECCCCCCHHHCC | 23684622 | ||
157 | Phosphorylation | FIHDQTSSNPKYRGF EEECCCCCCHHHCCH | 30352176 | ||
160 | Acetylation | DQTSSNPKYRGFFHG CCCCCCHHHCCHHHH | 23864654 | ||
160 | Ubiquitination | DQTSSNPKYRGFFHG CCCCCCHHHCCHHHH | 22790023 | ||
178 | Ubiquitination | IIREQGLKGTYQGLT HHHHCCCCCCCCCEE | 22790023 | ||
178 | Acetylation | IIREQGLKGTYQGLT HHHHCCCCCCCCCEE | 2415271 | ||
190 | Acetylation | GLTATVLKQGSNQAI CEEEEEECCCCCHHH | 23864654 | ||
216 | Acetylation | YQGDNHNKPMNPLIT HCCCCCCCCCCHHHH | 23954790 | ||
255 | Acetylation | MQGLEAHKYRNTLDC HCHHHHHHHHCCHHH | 23864654 | ||
255 | Malonylation | MQGLEAHKYRNTLDC HCHHHHHHHHCCHHH | 26320211 | ||
262 | S-palmitoylation | KYRNTLDCGLKILKN HHHCCHHHCCHHHHC | 26165157 | ||
265 | Acetylation | NTLDCGLKILKNEGP CCHHHCCHHHHCCCC | 23864654 | ||
265 | Ubiquitination | NTLDCGLKILKNEGP CCHHHCCHHHHCCCC | 22790023 | ||
268 | Succinylation | DCGLKILKNEGPKAF HHCCHHHHCCCCCCC | 23806337 | ||
268 | Acetylation | DCGLKILKNEGPKAF HHCCHHHHCCCCCCC | 23864654 | ||
276 | Phosphorylation | NEGPKAFYKGTVPRL CCCCCCCCCCCCCCH | 29514104 | ||
277 | Acetylation | EGPKAFYKGTVPRLG CCCCCCCCCCCCCHH | 23806337 | ||
277 | Succinylation | EGPKAFYKGTVPRLG CCCCCCCCCCCCCHH | 23806337 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TXTP_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TXTP_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TXTP_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of TXTP_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...