| UniProt ID | TXND5_MOUSE | |
|---|---|---|
| UniProt AC | Q91W90 | |
| Protein Name | Thioredoxin domain-containing protein 5 | |
| Gene Name | Txndc5 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 417 | |
| Subcellular Localization | Endoplasmic reticulum lumen . | |
| Protein Description | Possesses thioredoxin activity. Has been shown to reduce insulin disulfide bonds. Also complements protein disulfide-isomerase deficiency in yeast.. | |
| Protein Sequence | MPPRPGRLLQPLAGLPALATLLLLLGARKGARAQEVEADSGVEQDPHAKHLYTADMFTHGIQSAAHFVMFFAPWCGHCQRLQPTWNDLGDKYNSMEDAKVYVAKVDCTADSDVCSAQGVRGYPTLKFFKPGQEAVKYQGPRDFETLENWMLQTLNEEPATPEPEAEPPRAPELKQGLYELSANNFELHVSQGNHFIKFFAPWCGHCKALAPTWEQLALGLEHSETVKIGKVDCTQHYAVCSEHQVRGYPTLLWFRDGKKVDQYKGKRDLESLRDYVQSQLQGSEAAPETVEPSEAPVMAAEPTGDKGTVLALTEKSFEDTIAQGITFVKFYAPWCGHCKNLAPTWEELSKKEFPGLSDVTIAEVDCTAERNVCSKYSVRGYPTLLLFRGGEKVGEHNGGRDLDSLHSFVLRQAKDEL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 91 | Acetylation | TWNDLGDKYNSMEDA CHHHHHHHHCCHHHC | 44.53 | 22826441 | |
| 104 | Acetylation | DAKVYVAKVDCTADS HCEEEEEEEECCCCC | 28.67 | 22826441 | |
| 108 | Phosphorylation | YVAKVDCTADSDVCS EEEEEECCCCCCCCC | 29.09 | 20469934 | |
| 111 | Phosphorylation | KVDCTADSDVCSAQG EEECCCCCCCCCCCC | 29.49 | 26525534 | |
| 115 | Phosphorylation | TADSDVCSAQGVRGY CCCCCCCCCCCCCCC | 24.39 | 20469934 | |
| 126 | Ubiquitination | VRGYPTLKFFKPGQE CCCCCEEEEECCCCH | 51.76 | - | |
| 126 | Succinylation | VRGYPTLKFFKPGQE CCCCCEEEEECCCCH | 51.76 | 23954790 | |
| 129 | Acetylation | YPTLKFFKPGQEAVK CCEEEEECCCCHHHH | 51.90 | 22826441 | |
| 136 | Acetylation | KPGQEAVKYQGPRDF CCCCHHHHCCCCCCH | 38.61 | 23864654 | |
| 136 | Ubiquitination | KPGQEAVKYQGPRDF CCCCHHHHCCCCCCH | 38.61 | - | |
| 230 | Acetylation | SETVKIGKVDCTQHY CCCEEECEEECCCCE | 38.07 | 22826441 | |
| 233 | Glutathionylation | VKIGKVDCTQHYAVC EEECEEECCCCEEEC | 4.40 | 24333276 | |
| 237 | Phosphorylation | KVDCTQHYAVCSEHQ EEECCCCEEECCCCC | 7.30 | 25195567 | |
| 240 | Glutathionylation | CTQHYAVCSEHQVRG CCCCEEECCCCCCCC | 2.77 | 24333276 | |
| 264 | Acetylation | GKKVDQYKGKRDLES CCCCCCCCCCCCHHH | 52.93 | 6585147 | |
| 271 | Phosphorylation | KGKRDLESLRDYVQS CCCCCHHHHHHHHHH | 35.68 | 19367708 | |
| 315 | Acetylation | TVLALTEKSFEDTIA CEEEEEECCHHHHHH | 56.03 | 22826441 | |
| 373 | S-palmitoylation | CTAERNVCSKYSVRG CCCCCCCCCCCCCCC | 3.11 | 26165157 | |
| 375 | Acetylation | AERNVCSKYSVRGYP CCCCCCCCCCCCCCC | 36.10 | 22826441 | |
| 404 | Phosphorylation | NGGRDLDSLHSFVLR CCCCCHHHHHHHHHH | 34.97 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TXND5_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TXND5_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TXND5_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of TXND5_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
