TX1B3_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TX1B3_MOUSE
• UniProt AC: Q9DBG9
• Protein Name: Tax1-binding protein 3
• Gene Name: Tax1bp3 {ECO:0000312|MGI:MGI:1923531}
• Organism: Mus musculus (Mouse).
• Sequence Length: 124
• Subcellular Localization: Cytoplasm . Nucleus . Cell membrane; Peripheral membrane protein; Cytoplasmic side. Recruited to the cell membrane by interaction with membrane proteins..
• Protein Description: May regulate a number of protein-protein interactions by competing for PDZ domain binding sites. Binds CTNNB1 and may thereby act as an inhibitor of the Wnt signaling pathway. Competes with LIN7A for KCNJ4 binding, and thereby promotes KCNJ4 internalization. May play a role in the Rho signaling pathway (By similarity)..
• Protein Sequence: MSYTPGQPVTAVVQRVEIHKLRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKGIYVTRVSEGGPAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSLQKAVQQSMLS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MSYTPGQPV ------CCCCCCCCC	37.40	-
2	Phosphorylation	------MSYTPGQPV ------CCCCCCCCC	37.40	25619855
3	Phosphorylation	-----MSYTPGQPVT -----CCCCCCCCCE	18.69	25619855
4	Phosphorylation	----MSYTPGQPVTA ----CCCCCCCCCEE	17.40	25619855
56	Phosphorylation	DKTDKGIYVTRVSEG CCCCCCEEEEEECCC	12.39	23984901
58	Phosphorylation	TDKGIYVTRVSEGGP CCCCEEEEEECCCCC	14.37	24719451
61	Phosphorylation	GIYVTRVSEGGPAEI CEEEEEECCCCCCEE	27.51	25619855
61	O-linked_Glycosylation	GIYVTRVSEGGPAEI CEEEEEECCCCCCEE	27.51	30016717
101	Phosphorylation	RKRLTKRSEEVVRLL HHHHHHCCHHHHHHH	39.40	25338131
110	Phosphorylation	EVVRLLVTRQSLQKA HHHHHHHHHHHHHHH	23.98	29514104
113	Phosphorylation	RLLVTRQSLQKAVQQ HHHHHHHHHHHHHHH	29.49	24719451
124	Phosphorylation	AVQQSMLS------- HHHHHHCC-------	29.54	24719451

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TX1B3_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TX1B3_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TX1B3_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CTNB1_MOUSE	Ctnnb1	physical	12874278

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.