TVP23_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TVP23_SCHPO
• UniProt AC: Q9Y7K7
• Protein Name: Golgi apparatus membrane protein tvp23
• Gene Name: tvp23
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 219
• Subcellular Localization: Golgi apparatus membrane; Multi-pass membrane protein.
• Protein Description: Golgi membrane protein involved in vesicular trafficking..
• Protein Sequence: MFTSLDRNLYVDNHITLTKMDYQNTETIAEQERNASRLPQMFQMSSHPVALFFFLLFRTGAIVAYILGMFFTSSFMLLFIVIFTLLAVDLWTVKNVSGRLLVGLRWRNETGVDGESIWIFESADPSRPRNAVDQKTFWYALYLYPFIWIILGIVAIIRFEFLWLALVAVAIGLTSVNTAAYSRCDKDAKRRWATELADSNSSGFVSRFLSRAFIKRFIG

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
34	N-linked_Glycosylation	TIAEQERNASRLPQM HHHHHHHHHHHHHHH	41.33	-
95	N-linked_Glycosylation	VDLWTVKNVSGRLLV HHHHHHCCCCCCEEE	28.93	-
108	N-linked_Glycosylation	LVGLRWRNETGVDGE EEEEEEECCCCCCCC	44.19	-
200	N-linked_Glycosylation	ATELADSNSSGFVSR HHHHHCCCCCHHHHH	40.52	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TVP23_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TVP23_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TVP23_SCHPO !!

Protein-Protein Interaction

Oops, there are no PPI records of TVP23_SCHPO !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.