UniProt ID | TTHY_MOUSE | |
---|---|---|
UniProt AC | P07309 | |
Protein Name | Transthyretin | |
Gene Name | Ttr | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 147 | |
Subcellular Localization | Secreted. | |
Protein Description | Thyroid hormone-binding protein. Probably transports thyroxine from the bloodstream to the brain.. | |
Protein Sequence | MASLRLFLLCLAGLVFVSEAGPAGAGESKCPLMVKVLDAVRGSPAVDVAVKVFKKTSEGSWEPFASGKTAESGELHGLTTDEKFVEGVYRVELDTKSYWKTLGISPFHEFADVVFTANDSGHRHYTIAALLSPYSYSTTAVVSNPQN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
35 | Acetylation | SKCPLMVKVLDAVRG CCCCEEEHHHHHHCC | 24.10 | 21728379 | |
35 | Ubiquitination | SKCPLMVKVLDAVRG CCCCEEEHHHHHHCC | 24.10 | 22790023 | |
51 | Acetylation | PAVDVAVKVFKKTSE CHHHEEEEEEEECCC | 32.01 | 6584865 | |
55 | Ubiquitination | VAVKVFKKTSEGSWE EEEEEEEECCCCCCC | 45.90 | 22790023 | |
62 | 4-carboxyglutamate | KTSEGSWEPFASGKT ECCCCCCCCCCCCCE | 32.03 | - | |
62 | Gamma-carboxyglutamic_acid | KTSEGSWEPFASGKT ECCCCCCCCCCCCCE | 32.03 | - | |
68 | Ubiquitination | WEPFASGKTAESGEL CCCCCCCCEECCCCC | 41.91 | 22790023 | |
69 | Phosphorylation | EPFASGKTAESGELH CCCCCCCEECCCCCC | 38.90 | 19060867 | |
72 | Phosphorylation | ASGKTAESGELHGLT CCCCEECCCCCCCCC | 34.79 | 27742792 | |
79 | Phosphorylation | SGELHGLTTDEKFVE CCCCCCCCCCHHHHC | 36.47 | 27742792 | |
80 | Phosphorylation | GELHGLTTDEKFVEG CCCCCCCCCHHHHCE | 47.40 | 27742792 | |
83 | Ubiquitination | HGLTTDEKFVEGVYR CCCCCCHHHHCEEEE | 58.48 | 22790023 | |
96 | Ubiquitination | YRVELDTKSYWKTLG EEEEECCHHHHHHCC | 41.01 | - | |
96 | Succinylation | YRVELDTKSYWKTLG EEEEECCHHHHHHCC | 41.01 | 23954790 | |
118 | N-linked_Glycosylation | ADVVFTANDSGHRHY EEEEEECCCCCCCEE | 40.71 | 17330941 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TTHY_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TTHY_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TTHY_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of TTHY_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
N-linked Glycosylation | |
Reference | PubMed |
"Enhanced analysis of the mouse plasma proteome using cysteine-containing tryptic glycopeptides."; Bernhard O.K., Kapp E.A., Simpson R.J.; J. Proteome Res. 6:987-995(2007). Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-118, AND MASSSPECTROMETRY. |