| UniProt ID | TTHY_MOUSE | |
|---|---|---|
| UniProt AC | P07309 | |
| Protein Name | Transthyretin | |
| Gene Name | Ttr | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 147 | |
| Subcellular Localization | Secreted. | |
| Protein Description | Thyroid hormone-binding protein. Probably transports thyroxine from the bloodstream to the brain.. | |
| Protein Sequence | MASLRLFLLCLAGLVFVSEAGPAGAGESKCPLMVKVLDAVRGSPAVDVAVKVFKKTSEGSWEPFASGKTAESGELHGLTTDEKFVEGVYRVELDTKSYWKTLGISPFHEFADVVFTANDSGHRHYTIAALLSPYSYSTTAVVSNPQN | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 35 | Acetylation | SKCPLMVKVLDAVRG CCCCEEEHHHHHHCC | 24.10 | 21728379 | |
| 35 | Ubiquitination | SKCPLMVKVLDAVRG CCCCEEEHHHHHHCC | 24.10 | 22790023 | |
| 51 | Acetylation | PAVDVAVKVFKKTSE CHHHEEEEEEEECCC | 32.01 | 6584865 | |
| 55 | Ubiquitination | VAVKVFKKTSEGSWE EEEEEEEECCCCCCC | 45.90 | 22790023 | |
| 62 | 4-carboxyglutamate | KTSEGSWEPFASGKT ECCCCCCCCCCCCCE | 32.03 | - | |
| 62 | Gamma-carboxyglutamic_acid | KTSEGSWEPFASGKT ECCCCCCCCCCCCCE | 32.03 | - | |
| 68 | Ubiquitination | WEPFASGKTAESGEL CCCCCCCCEECCCCC | 41.91 | 22790023 | |
| 69 | Phosphorylation | EPFASGKTAESGELH CCCCCCCEECCCCCC | 38.90 | 19060867 | |
| 72 | Phosphorylation | ASGKTAESGELHGLT CCCCEECCCCCCCCC | 34.79 | 27742792 | |
| 79 | Phosphorylation | SGELHGLTTDEKFVE CCCCCCCCCCHHHHC | 36.47 | 27742792 | |
| 80 | Phosphorylation | GELHGLTTDEKFVEG CCCCCCCCCHHHHCE | 47.40 | 27742792 | |
| 83 | Ubiquitination | HGLTTDEKFVEGVYR CCCCCCHHHHCEEEE | 58.48 | 22790023 | |
| 96 | Ubiquitination | YRVELDTKSYWKTLG EEEEECCHHHHHHCC | 41.01 | - | |
| 96 | Succinylation | YRVELDTKSYWKTLG EEEEECCHHHHHHCC | 41.01 | 23954790 | |
| 118 | N-linked_Glycosylation | ADVVFTANDSGHRHY EEEEEECCCCCCCEE | 40.71 | 17330941 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TTHY_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TTHY_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TTHY_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of TTHY_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| N-linked Glycosylation | |
| Reference | PubMed |
| "Enhanced analysis of the mouse plasma proteome using cysteine-containing tryptic glycopeptides."; Bernhard O.K., Kapp E.A., Simpson R.J.; J. Proteome Res. 6:987-995(2007). Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-118, AND MASSSPECTROMETRY. | |
