UniProt ID | TTC32_HUMAN | |
---|---|---|
UniProt AC | Q5I0X7 | |
Protein Name | Tetratricopeptide repeat protein 32 | |
Gene Name | TTC32 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 151 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MEGQRQESHATLTLAQAHFNNGEYAEAEALYSAYIRRCACAASSDESPGSKCSPEDLATAYNNRGQIKYFRVDFYEAMDDYTSAIEVQPNFEVPYYNRGLILYRLGYFDDALEDFKKVLDLNPGFQDATLSLKQTILDKEEKQRRNVAKNY | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
51 | Ubiquitination | SDESPGSKCSPEDLA CCCCCCCCCCHHHHH | 44.65 | 29967540 | |
69 | Phosphorylation | NNRGQIKYFRVDFYE HCCCCEEEEEEEHHH | 9.76 | - | |
75 | Phosphorylation | KYFRVDFYEAMDDYT EEEEEEHHHHHCCCC | 9.79 | - | |
96 | Phosphorylation | PNFEVPYYNRGLILY CCCCCCCCCCCEEEH | 7.72 | - | |
116 | Ubiquitination | DDALEDFKKVLDLNP HHHHHHHHHHHCCCC | 55.05 | 22817900 | |
117 | Ubiquitination | DALEDFKKVLDLNPG HHHHHHHHHHCCCCC | 48.28 | 22817900 | |
133 | Ubiquitination | QDATLSLKQTILDKE HHHHHHHHHHHHCHH | 41.86 | 29967540 | |
139 | Ubiquitination | LKQTILDKEEKQRRN HHHHHHCHHHHHHHH | 65.41 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TTC32_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TTC32_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TTC32_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CNDH2_HUMAN | NCAPH2 | physical | 21516116 | |
MYOG_HUMAN | MYOG | physical | 21516116 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...