UniProt ID | TSPY1_HUMAN | |
---|---|---|
UniProt AC | Q01534 | |
Protein Name | Testis-specific Y-encoded protein 1 | |
Gene Name | TSPY1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 308 | |
Subcellular Localization | Cytoplasm . Nucleus . Predominantly cytoplasmic. Also found in nucleus. | |
Protein Description | May be involved in sperm differentiation and proliferation.. | |
Protein Sequence | MRPEGSLTYRVPERLRQGFCGVGRAAQALVCASAKEGTAFRMEAVQEGAAGVESEQAALGEEAVLLLDDIMAEVEVVAEEEGLVERREEAQRAQQAVPGPGPMTPESAPEELLAVQVELEPVNAQARKAFSRQREKMERRRKPHLDRRGAVIQSVPGFWANVIANHPQMSALITDEDEDMLSYMVSLEVGEEKHPVHLCKIMLFFRSNPYFQNKVITKEYLVNITEYRASHSTPIEWYPDYEVEAYRRRHHNSSLNFFNWFSDHNFAGSNKIAEILCKDLWRNPLQYYKRMKPPEEGTETSGDSQLLS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
35 | Ubiquitination | ALVCASAKEGTAFRM HHHHHCCCCCCCEEH | 54.93 | - | |
136 | Ubiquitination | AFSRQREKMERRRKP HHHHHHHHHHHHCCC | 48.53 | - | |
142 | Ubiquitination | EKMERRRKPHLDRRG HHHHHHCCCCHHHHC | 34.67 | - | |
193 | Ubiquitination | SLEVGEEKHPVHLCK EEECCCCCCHHHEEE | 49.24 | - | |
214 | Ubiquitination | SNPYFQNKVITKEYL CCHHHCCCCCCHHHE | 25.00 | 21906983 | |
214 (in isoform 2) | Ubiquitination | - | 25.00 | 21906983 | |
214 (in isoform 1) | Ubiquitination | - | 25.00 | 21906983 | |
218 (in isoform 2) | Ubiquitination | - | 32.98 | 21906983 | |
218 (in isoform 1) | Ubiquitination | - | 32.98 | 21906983 | |
218 | Ubiquitination | FQNKVITKEYLVNIT HCCCCCCHHHEEEHH | 32.98 | 21906983 | |
253 | Phosphorylation | YRRRHHNSSLNFFNW HHHHHCCCCCCEEHH | 31.67 | - | |
271 | Ubiquitination | HNFAGSNKIAEILCK CCCCCCHHHHHHHHH | 45.02 | 21906983 | |
271 (in isoform 1) | Ubiquitination | - | 45.02 | 21906983 | |
278 | Ubiquitination | KIAEILCKDLWRNPL HHHHHHHHHHHCCHH | 53.03 | 21906983 | |
278 (in isoform 1) | Ubiquitination | - | 53.03 | 21906983 | |
289 | Ubiquitination | RNPLQYYKRMKPPEE CCHHHHHHHCCCCCC | 40.87 | 21906983 | |
289 (in isoform 1) | Ubiquitination | - | 40.87 | 21906983 | |
292 | Ubiquitination | LQYYKRMKPPEEGTE HHHHHHCCCCCCCCC | 62.55 | 2190698 | |
292 (in isoform 1) | Ubiquitination | - | 62.55 | 21906983 | |
300 | Phosphorylation | PPEEGTETSGDSQLL CCCCCCCCCCCCCCC | 37.54 | 16426576 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
300 | T | Phosphorylation | Kinase | CSNK2A1 | P68400 | GPS |
300 | T | Phosphorylation | Kinase | CK2-FAMILY | - | GPS |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TSPY1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TSPY1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
H2A2C_HUMAN | HIST2H2AC | physical | 16996029 | |
H2B2E_HUMAN | HIST2H2BE | physical | 16996029 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...