TRXX_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TRXX_ARATH
• UniProt AC: Q8LD49
• Protein Name: Thioredoxin X, chloroplastic
• Gene Name: ATHX
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 182
• Subcellular Localization: Plastid, chloroplast stroma .
• Protein Description: Probable thiol-disulfide oxidoreductase that may participate in various redox reactions..
• Protein Sequence: MDSIVSSSTILMRSYLTPPVRSCSPATSVSVKPLSSVQVTSVAANRHLLSLSSGARRTRKSSSSVIRCGGIKEIGESEFSSTVLESAQPVLVEFVATWCGPCKLIYPAMEALSQEYGDKLTIVKIDHDANPKLIAEFKVYGLPHFILFKDGKEVPGSRREGAITKAKLKEYIDGLLNSISVA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
28	Phosphorylation	RSCSPATSVSVKPLS CCCCCCCEEEEEECC	17.94	28011693
30	Phosphorylation	CSPATSVSVKPLSSV CCCCCEEEEEECCCC	24.96	28011693
61	Phosphorylation	GARRTRKSSSSVIRC CCCCCCCCCCCEEEE	31.96	24894044
121	Phosphorylation	QEYGDKLTIVKIDHD HHHCCCEEEEEECCC	29.48	24894044

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TRXX_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TRXX_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TRXX_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of TRXX_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.