TRXM2_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TRXM2_ARATH
• UniProt AC: Q9SEU8
• Protein Name: Thioredoxin M2, chloroplastic
• Gene Name: At4g03520
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 186
• Subcellular Localization: Plastid, chloroplast stroma .
• Protein Description: Thiol-disulfide oxidoreductase that may participate in various redox reactions. May activate NADP-malate dehydrogenase..
• Protein Sequence: MAAFTCTSRPPISLRSETRIVSSSPSASSLSSRRMFAVLPESSGLRIRLSLSPASLTSIHQPRVSRLRRAVVCEAQETTTDIQVVNDSTWDSLVLKATGPVVVDFWAPWCGPCKMIDPLVNDLAQHYTGKIKFYKLNTDESPNTPGQYGVRSIPTIMIFVGGEKKDTIIGAVPKTTLTSSLDKFLP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
115	Sulfoxidation	PWCGPCKMIDPLVND CCCCCCHHHHHHHHH	5.53	25693801
180	Phosphorylation	PKTTLTSSLDKFLP- CCCCCHHHHHHCCC-	35.04	19880383

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TRXM2_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TRXM2_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TRXM2_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
VDAC3_ARATH	VDAC3	physical	25862497

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.