dbPTM

TRXF2_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	TRXF2_ARATH
UniProt AC	Q9XFH9
Protein Name	Thioredoxin F2, chloroplastic
Gene Name	At5g16400
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	185
Subcellular Localization	Plastid, chloroplast stroma .
Protein Description	Probable thiol-disulfide oxidoreductase involved in the redox regulation of enzymes of both reductive pentose phosphate pathway (Calvin-Benson cycle) and oxidative pentose phosphate pathway..
Protein Sequence	MPLSLRLAPSPTSFRYSPITSTGAGGFSPVKQHCRIPNSGVATKIGFCSGGGGVLDSGRRIGSCVVRCSLETVNVTVGQVTEVDKDTFWPIVKAAGDKIVVLDMYTQWCGPCKVIAPKYKELSEKYQDMVFLKLDCNQDNKPLAKELGIRVVPTFKILKDNKVVKEVTGAKYEDLLAAIEAARSG

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
49	Phosphorylation	ATKIGFCSGGGGVLD CCEEEECCCCCCCCC	37.91	27545962
57	Phosphorylation	GGGGVLDSGRRIGSC CCCCCCCCCCEEECE	30.00	27545962
129	Sulfoxidation	LSEKYQDMVFLKLDC HHHHHCCEEEEEECC	1.04	25693801
136	Glutathionylation	MVFLKLDCNQDNKPL EEEEEECCCCCCCHH	7.74	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of TRXF2_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
136	C	Glutathionylation		-
Glutathionylation at Cys-136 decreases its ability to be reduced by ferredoxin-thioredoxin reductase and reduces its efficiency in activating target chloroplastic enzymes.

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of TRXF2_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of TRXF2_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of TRXF2_ARATH

Related Literatures of Post-Translational Modification