TRS20_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TRS20_SCHPO
• UniProt AC: Q9USZ5
• Protein Name: Transport protein particle 20 kDa subunit
• Gene Name: trs20
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 136
• Subcellular Localization: Cytoplasm . Golgi apparatus, cis-Golgi network. Endoplasmic reticulum.
• Protein Description: Component of the TRAPP I and TRAPP II complexes. TRAPP I plays a key role in the late stages of endoplasmic reticulum to Golgi traffic. TRAPP II seems to play a role in intra-Golgi transport (By similarity)..
• Protein Sequence: MTAYAAIIGTKDNPVYELEMGPINEKLDRSLNSHLNQFIVHSSLDIVDQLQWTSNAFYMKTIDQFHEMYISAYVTPSNMRFMLLHQNQSADNIKLFFQELHELYIKTLMSPFYQPNQPIRSQAFDLKVRSIARRYL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of TRS20_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TRS20_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TRS20_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TRS20_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SEC6_SCHPO	sec6	physical	26771498

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.