UniProt ID | TRMO_HUMAN | |
---|---|---|
UniProt AC | Q9BU70 | |
Protein Name | tRNA (adenine(37)-N6)-methyltransferase {ECO:0000305} | |
Gene Name | TRMO {ECO:0000303|PubMed:25063302, ECO:0000312|HGNC:HGNC:30967} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 441 | |
Subcellular Localization | ||
Protein Description | S-adenosyl-L-methionine-dependent methyltransferase responsible for the addition of the methyl group in the formation of N6-methyl-N6-threonylcarbamoyladenosine at position 37 (m(6)t(6)A37) of the tRNA anticodon loop of tRNA(Ser)(GCU). [PubMed: 25063302 The methyl group of m(6)t(6)A37 may improve the efficiency of the tRNA decoding ability. May bind to tRNA (By similarity] | |
Protein Sequence | MRGLEESGPRPTATPCGCVKPALETGNLLTEPVGYLESCFSAKNGTPRQPSICSYSRACLRIRKRIFNNPEHSLMGLEQFSHVWILFVFHKNGHLSCKAKVQPPRLNGAKTGVFSTRSPHRPNAIGLTLAKLEKVEGGAIYLSGIDMIHGTPVLDIKPYIAEYDSPQNVMEPLADFNLQNNQHTPNTVSQSDSKTDSCDQRQLSGCDEPQPHHSTKRKPKCPEDRTSEENYLTHSDTARIQQAFPMHREIAVDFGLESRRDQSSSVAEEQIGPYCPEKSFSEKGTDKKLERVEGAAVLQGSRAETQPMAPHCPAGRADGAPRSVVPAWVTEAPVATLEVRFTPHAEMDLGQLSSQDVGQASFKYFQSAEEAKRAIEAVLSADPRSVYRRKLCQDRLFYFTVDIAHVTCWFGDGFAEVLRIKPASEPVHMTGPVGSLVSLGS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
100 | Ubiquitination | GHLSCKAKVQPPRLN CCEEEEEEECCCCCC | - | ||
110 | Ubiquitination | PPRLNGAKTGVFSTR CCCCCCCCEECEECC | - | ||
118 | Phosphorylation | TGVFSTRSPHRPNAI EECEECCCCCCCCCC | 25159151 | ||
163 | Phosphorylation | IKPYIAEYDSPQNVM CCCCEECCCCCCCCC | - | ||
184 | Phosphorylation | NLQNNQHTPNTVSQS CCCCCCCCCCCCCCC | 25159151 | ||
204 | Phosphorylation | SCDQRQLSGCDEPQP CCCHHHHCCCCCCCC | - | ||
214 | Phosphorylation | DEPQPHHSTKRKPKC CCCCCCCCCCCCCCC | 25627689 | ||
215 | Phosphorylation | EPQPHHSTKRKPKCP CCCCCCCCCCCCCCC | 25627689 | ||
231 | Phosphorylation | DRTSEENYLTHSDTA CCCCCCCCCCHHHHH | 22468782 | ||
235 | Phosphorylation | EENYLTHSDTARIQQ CCCCCCHHHHHHHHH | 22468782 | ||
237 | Phosphorylation | NYLTHSDTARIQQAF CCCCHHHHHHHHHHC | - | ||
265 | Phosphorylation | SRRDQSSSVAEEQIG CCCCCCCCHHHHHHC | 28555341 | ||
361 | Phosphorylation | SQDVGQASFKYFQSA CCCHHHHHHHHHHCH | 24719451 | ||
363 | Ubiquitination | DVGQASFKYFQSAEE CHHHHHHHHHHCHHH | - | ||
372 | Ubiquitination | FQSAEEAKRAIEAVL HHCHHHHHHHHHHHH | - | ||
380 | Phosphorylation | RAIEAVLSADPRSVY HHHHHHHHCCHHHHH | 30257219 | ||
421 | Ubiquitination | FAEVLRIKPASEPVH HHHCCEEEECCCCEE | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TRMO_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TRMO_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TRMO_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RHPN2_HUMAN | RHPN2 | physical | 26186194 | |
STA5B_HUMAN | STAT5B | physical | 28514442 | |
RHPN2_HUMAN | RHPN2 | physical | 28514442 | |
VP26B_HUMAN | VPS26B | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...