UniProt ID | TRML1_MOUSE | |
---|---|---|
UniProt AC | Q8K558 | |
Protein Name | Trem-like transcript 1 protein | |
Gene Name | Treml1 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 317 | |
Subcellular Localization |
Cell membrane Single-pass type I membrane protein . Cytoplasm . Sequestered in cytoplasmic vesicles in resting platelets. Transported to the cell surface after stimulation by thrombin. Soluble fragments can be released into the serum by proteolysis |
|
Protein Description | Cell surface receptor that may play a role in the innate and adaptive immune response.. | |
Protein Sequence | MDCYLLLLLLLLGLAGQGSADSHPEVLQAPVGSSILVQCHYRLQDVRALKVWCQFLQEGCHPLVTSAVDRRAPGNGRIFLTDLGGGLLQVEMVTLQEEDTGEYGCVVEGAAGPQTLHRVSLLVLPPVPGPREGEEAEDEKETYRIGTGSLLEDPSLDPSASAGPHEFRRRENSIPLIWGAVLLLALVVVAVVIFAVMARKKGNRLVVCGPSQSTGVPGMDPPSAAHRSSDSGLPSDIPHVRLDSPPSFDSIYTGSSLDPPSSEPPAPPSQPPLPPKVLMSSKSVTYATVVFPGGDKGKIASCEPVQDPPNSQTPPSK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
208 | S-palmitoylation | KGNRLVVCGPSQSTG CCCEEEEECCCCCCC | 5.31 | - | |
211 | Phosphorylation | RLVVCGPSQSTGVPG EEEEECCCCCCCCCC | 23.26 | 29472430 | |
213 | Phosphorylation | VVCGPSQSTGVPGMD EEECCCCCCCCCCCC | 31.31 | 29472430 | |
214 | Phosphorylation | VCGPSQSTGVPGMDP EECCCCCCCCCCCCC | 34.26 | 29472430 | |
228 | Phosphorylation | PPSAAHRSSDSGLPS CCCHHHCCCCCCCCC | 28.73 | 25521595 | |
229 | Phosphorylation | PSAAHRSSDSGLPSD CCHHHCCCCCCCCCC | 35.43 | 27742792 | |
231 | Phosphorylation | AAHRSSDSGLPSDIP HHHCCCCCCCCCCCC | 44.15 | 28833060 | |
233 | Phosphorylation | HRSSDSGLPSDIPHV HCCCCCCCCCCCCCE | 4.20 | 24719451 | |
235 | Phosphorylation | SSDSGLPSDIPHVRL CCCCCCCCCCCCEEC | 53.89 | 28833060 | |
283 | Phosphorylation | KVLMSSKSVTYATVV CEEECCCCEEEEEEE | 22.95 | 25521595 | |
285 | Phosphorylation | LMSSKSVTYATVVFP EECCCCEEEEEEEEC | 17.96 | 27742792 | |
286 | Phosphorylation | MSSKSVTYATVVFPG ECCCCEEEEEEEECC | 9.71 | 29472430 | |
288 | Phosphorylation | SKSVTYATVVFPGGD CCCEEEEEEEECCCC | 13.54 | 25521595 | |
296 | Ubiquitination | VVFPGGDKGKIASCE EEECCCCCCCEEECC | 66.43 | - | |
298 | Ubiquitination | FPGGDKGKIASCEPV ECCCCCCCEEECCCC | 40.62 | - | |
311 | Phosphorylation | PVQDPPNSQTPPSK- CCCCCCCCCCCCCC- | 41.00 | 29472430 | |
313 | Phosphorylation | QDPPNSQTPPSK--- CCCCCCCCCCCC--- | 36.67 | 29472430 | |
316 | Phosphorylation | PNSQTPPSK------ CCCCCCCCC------ | 52.80 | 29472430 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TRML1_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TRML1_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TRML1_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of TRML1_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Mitochondrial phosphoproteome revealed by an improved IMAC method andMS/MS/MS."; Lee J., Xu Y., Chen Y., Sprung R., Kim S.C., Xie S., Zhao Y.; Mol. Cell. Proteomics 6:669-676(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-228, AND MASSSPECTROMETRY. | |
"Large-scale phosphorylation analysis of mouse liver."; Villen J., Beausoleil S.A., Gerber S.A., Gygi S.P.; Proc. Natl. Acad. Sci. U.S.A. 104:1488-1493(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-285, AND MASSSPECTROMETRY. |