| UniProt ID | TREX2_MOUSE | |
|---|---|---|
| UniProt AC | Q9R1A9 | |
| Protein Name | Three prime repair exonuclease 2 | |
| Gene Name | Trex2 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 236 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Exonuclease with a preference for double-stranded DNA with mismatched 3' termini. May play a role in DNA repair.. | |
| Protein Sequence | MSEPPRAETFVFLDLEATGLPNMDPEIAEISLFAVHRSSLENPERDDSGSLVLPRVLDKLTLCMCPERPFTAKASEITGLSSESLMHCGKAGFNGAVVRTLQGFLSRQEGPICLVAHNGFDYDFPLLCTELQRLGAHLPQDTVCLDTLPALRGLDRAHSHGTRAQGRKSYSLASLFHRYFQAEPSAAHSAEGDVHTLLLIFLHRAPELLAWADEQARSWAHIEPMYVPPDGPSLEA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 38 | Phosphorylation | SLFAVHRSSLENPER EEEEEEHHHCCCCCC | 25.13 | 23832136 | |
| 61 | Phosphorylation | PRVLDKLTLCMCPER HHHHCCCEEEECCCC | 24.53 | - | |
| 71 | Phosphorylation | MCPERPFTAKASEIT ECCCCCCCCCHHHHC | 29.90 | - | |
| 171 | Phosphorylation | AQGRKSYSLASLFHR CCCCHHHHHHHHHHH | 25.26 | 28507225 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TREX2_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TREX2_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TREX2_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of TREX2_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...