UniProt ID | TREX2_MOUSE | |
---|---|---|
UniProt AC | Q9R1A9 | |
Protein Name | Three prime repair exonuclease 2 | |
Gene Name | Trex2 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 236 | |
Subcellular Localization | Nucleus . | |
Protein Description | Exonuclease with a preference for double-stranded DNA with mismatched 3' termini. May play a role in DNA repair.. | |
Protein Sequence | MSEPPRAETFVFLDLEATGLPNMDPEIAEISLFAVHRSSLENPERDDSGSLVLPRVLDKLTLCMCPERPFTAKASEITGLSSESLMHCGKAGFNGAVVRTLQGFLSRQEGPICLVAHNGFDYDFPLLCTELQRLGAHLPQDTVCLDTLPALRGLDRAHSHGTRAQGRKSYSLASLFHRYFQAEPSAAHSAEGDVHTLLLIFLHRAPELLAWADEQARSWAHIEPMYVPPDGPSLEA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
38 | Phosphorylation | SLFAVHRSSLENPER EEEEEEHHHCCCCCC | 25.13 | 23832136 | |
61 | Phosphorylation | PRVLDKLTLCMCPER HHHHCCCEEEECCCC | 24.53 | - | |
71 | Phosphorylation | MCPERPFTAKASEIT ECCCCCCCCCHHHHC | 29.90 | - | |
171 | Phosphorylation | AQGRKSYSLASLFHR CCCCHHHHHHHHHHH | 25.26 | 28507225 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TREX2_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TREX2_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TREX2_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of TREX2_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...