TRBP2_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TRBP2_MOUSE
• UniProt AC: P97473
• Protein Name: RISC-loading complex subunit TARBP2 {ECO:0000255|HAMAP-Rule:MF_03034}
• Gene Name: Tarbp2
• Organism: Mus musculus (Mouse).
• Sequence Length: 365
• Subcellular Localization: Cytoplasm . Cytoplasm, perinuclear region . Nucleus .
• Protein Description: Required for formation of the RNA induced silencing complex (RISC). Component of the RISC loading complex (RLC), also known as the micro-RNA (miRNA) loading complex (miRLC), which is composed of DICER1, AGO2 and TARBP2. Within the RLC/miRLC, DICER1 and TARBP2 are required to process precursor miRNAs (pre-miRNAs) to mature miRNAs and then load them onto AGO2. AGO2 bound to the mature miRNA constitutes the minimal RISC and may subsequently dissociate from DICER1 and TARBP2. May also play a role in the production of short interfering RNAs (siRNAs) from double-stranded RNA (dsRNA) by DICER1 (By similarity). Binds in vitro to the PRM1 3'-UTR. Seems to act as a repressor of translation. [PubMed: 8649414]
• Protein Sequence: MSEEDQGSGTTTGCGLPSIEQMLAANPGKTPISLLQEYGTRIGKTPVYDLLKAEGQAHQPNFTFRVTVGDTSCTGQGPSKKAAKHKAAEVALKHLKGGSMLEPALEDSSSFSLLDSSPPEDTPVVAAEAAAPVPSAVLTRSPPMEMQPPVSPQQSECNPVGALQELVVQKGWRLPEYMVTQESGPAHRKEFTMTCRVERFIEIGSGTSKKLAKRNAAAKMLLRVHTVPLDARDGNEAEPDDDHFSIGVSSRLDGLRNRGPGCTWDSLRNSVGEKILSLRSCSVGSLGALGSACCSVLSELSEEQAFHVSYLDIEELSLSGLCQCLVELSTQPATVCYGSATTREAARGDAAHRALQYLRIMAGSK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSEEDQGSG ------CCCCCCCCC	50.09	25293948
8	Phosphorylation	MSEEDQGSGTTTGCG CCCCCCCCCCCCCCC	27.60	25293948
10	Phosphorylation	EEDQGSGTTTGCGLP CCCCCCCCCCCCCCC	23.92	25293948
67	Phosphorylation	PNFTFRVTVGDTSCT CCEEEEEEECCCCCC	17.95	21930439
71	Phosphorylation	FRVTVGDTSCTGQGP EEEEECCCCCCCCCC	21.55	21930439
79	Phosphorylation	SCTGQGPSKKAAKHK CCCCCCCCHHHHHHH	54.32	21930439
117	Phosphorylation	SFSLLDSSPPEDTPV CCCCCCCCCCCCCCC	44.11	25338131
141	Phosphorylation	PSAVLTRSPPMEMQP CCCEEECCCCCCCCC	28.28	25159016
151	Phosphorylation	MEMQPPVSPQQSECN CCCCCCCCCCCCCCC	23.82	27087446
155	Phosphorylation	PPVSPQQSECNPVGA CCCCCCCCCCCCCHH	38.58	24453211
205	Phosphorylation	ERFIEIGSGTSKKLA EEEEECCCCCCHHHH	44.55	23737553
207	Phosphorylation	FIEIGSGTSKKLAKR EEECCCCCCHHHHHH	38.79	23737553
208	Phosphorylation	IEIGSGTSKKLAKRN EECCCCCCHHHHHHH	31.17	23737553
245	Phosphorylation	EPDDDHFSIGVSSRL CCCCCCCCEEHHHHH	18.27	23684622

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TRBP2_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TRBP2_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TRBP2_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of TRBP2_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.