UniProt ID | TPPP3_RAT | |
---|---|---|
UniProt AC | Q5PPN5 | |
Protein Name | Tubulin polymerization-promoting protein family member 3 | |
Gene Name | Tppp3 | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 176 | |
Subcellular Localization | Cytoplasm, cytoskeleton . | |
Protein Description | Binds tubulin and has microtubule bundling activity. May play a role in cell proliferation and mitosis (By similarity).. | |
Protein Sequence | MAASTDIAGLEESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKAVTGTDVDIVFSKVKAKSARVINYEEFKKALEELATKRFKGKTKEEAFDAICQLIAGKEPANIGVTKAKTGGAVDRLTDTSKYTGSHKERFDESGKGKGIAGRQDILDDSGYVSAYKNAGTYDAKVKK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MAASTDIAG ------CCCCCCCCC | 15.32 | - | |
24 | Acetylation | FAIHGDPKASGQEMN HHHCCCCCCCCCCCC | 60.98 | 22902405 | |
33 | Acetylation | SGQEMNGKNWAKLCK CCCCCCCCHHHHHCC | 44.29 | 22902405 | |
76 | Acetylation | VINYEEFKKALEELA EECHHHHHHHHHHHH | 40.18 | 22902405 | |
77 | Ubiquitination | INYEEFKKALEELAT ECHHHHHHHHHHHHH | 64.62 | - | |
130 | Acetylation | DRLTDTSKYTGSHKE CCCCCCCCCCCCCHH | 49.26 | 22902405 | |
144 | Acetylation | ERFDESGKGKGIAGR HHCCCCCCCCCCCCC | 67.72 | 72532525 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TPPP3_RAT !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TPPP3_RAT !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TPPP3_RAT !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of TPPP3_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...