| UniProt ID | TPM4_RAT | |
|---|---|---|
| UniProt AC | P09495 | |
| Protein Name | Tropomyosin alpha-4 chain | |
| Gene Name | Tpm4 | |
| Organism | Rattus norvegicus (Rat). | |
| Sequence Length | 248 | |
| Subcellular Localization | Cytoplasm, cytoskeleton . Associates with F-actin stress fibers (PubMed:7568216). | |
| Protein Description | Binds to actin filaments in muscle and non-muscle cells. [PubMed: 7568216 Plays a central role, in association with the troponin complex, in the calcium dependent regulation of vertebrate striated muscle contraction (By similarity Smooth muscle contraction is regulated by interaction with caldesmon (By similarity In non-muscle cells is implicated in stabilizing cytoskeleton actin filaments (By similarity Binds calcium (By similarity] | |
| Protein Sequence | MAGLNSLEAVKRKIQALQQQADDAEDRAQGLQRELDGERERREKAEGDAAALNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRAMKDEEKMEIQEMQLKEAKHIAEEADRKYEEVARKLVILEGELERAEERAEVSELKSSDLEEELKNVTNNLKSLEAASEKYSEKEDKYEEEIKLLSDKLKEAETRAEFAERTVSKLEKTIDDLEEKLAQAKEENVGLHQTLDQTLNELNCI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MAGLNSLEA ------CCCHHHHHH | 31.05 | - | |
| 6 | Phosphorylation | --MAGLNSLEAVKRK --CCCHHHHHHHHHH | 32.40 | 27097102 | |
| 11 | Acetylation | LNSLEAVKRKIQALQ HHHHHHHHHHHHHHH | 55.83 | 22902405 | |
| 44 | Acetylation | GERERREKAEGDAAA HHHHHHHHHHHHHHH | 50.34 | 22902405 | |
| 44 | Succinylation | GERERREKAEGDAAA HHHHHHHHHHHHHHH | 50.34 | 26843850 | |
| 72 | Phosphorylation | RAQERLATALQKLEE HHHHHHHHHHHHHHH | 32.28 | 22673903 | |
| 76 | Acetylation | RLATALQKLEEAEKA HHHHHHHHHHHHHHH | 59.73 | 59120655 | |
| 82 | Acetylation | QKLEEAEKAADESER HHHHHHHHHHHHHHH | 56.79 | 59120643 | |
| 92 | Acetylation | DESERGMKVIENRAM HHHHHHHHHHHHHHC | 42.77 | 22902405 | |
| 100 | Acetylation | VIENRAMKDEEKMEI HHHHHHCCHHHHHHH | 62.09 | 22902405 | |
| 104 | Acetylation | RAMKDEEKMEIQEMQ HHCCHHHHHHHHHHH | 39.52 | 26302492 | |
| 113 | Acetylation | EIQEMQLKEAKHIAE HHHHHHHHHHHHHHH | 38.44 | 26302492 | |
| 116 | Acetylation | EMQLKEAKHIAEEAD HHHHHHHHHHHHHHH | 36.31 | 22902405 | |
| 125 | Acetylation | IAEEADRKYEEVARK HHHHHHHHHHHHHHH | 58.52 | 26302492 | |
| 126 | Phosphorylation | AEEADRKYEEVARKL HHHHHHHHHHHHHHH | 20.44 | 22673903 | |
| 132 | Acetylation | KYEEVARKLVILEGE HHHHHHHHHHHHHHH | 37.05 | 22902405 | |
| 150 | Phosphorylation | AEERAEVSELKSSDL HHHHHHHHHHHHCHH | 28.81 | 22673903 | |
| 153 | Acetylation | RAEVSELKSSDLEEE HHHHHHHHHCHHHHH | 43.81 | 22902405 | |
| 154 | Phosphorylation | AEVSELKSSDLEEEL HHHHHHHHCHHHHHH | 41.53 | 22673903 | |
| 155 | Phosphorylation | EVSELKSSDLEEELK HHHHHHHCHHHHHHH | 44.63 | 18779572 | |
| 162 | Acetylation | SDLEEELKNVTNNLK CHHHHHHHHHHHHHH | 53.29 | 22902405 | |
| 169 | Acetylation | KNVTNNLKSLEAASE HHHHHHHHHHHHHHH | 55.93 | 22902405 | |
| 177 | Acetylation | SLEAASEKYSEKEDK HHHHHHHHHHHHHHH | 52.13 | 22902405 | |
| 181 | Acetylation | ASEKYSEKEDKYEEE HHHHHHHHHHHHHHH | 66.33 | 22902405 | |
| 184 | Acetylation | KYSEKEDKYEEEIKL HHHHHHHHHHHHHHH | 56.50 | 22902405 | |
| 195 | Acetylation | EIKLLSDKLKEAETR HHHHHHHHHHHHHHH | 59.07 | 22902405 | |
| 197 | Acetylation | KLLSDKLKEAETRAE HHHHHHHHHHHHHHH | 61.70 | 59120667 | |
| 201 | Phosphorylation | DKLKEAETRAEFAER HHHHHHHHHHHHHHH | 42.08 | 22673903 | |
| 212 | Acetylation | FAERTVSKLEKTIDD HHHHHHHHHHHHHHH | 57.22 | 22902405 | |
| 215 | Acetylation | RTVSKLEKTIDDLEE HHHHHHHHHHHHHHH | 62.31 | 59120651 | |
| 216 | Phosphorylation | TVSKLEKTIDDLEEK HHHHHHHHHHHHHHH | 21.91 | - | |
| 223 | Acetylation | TIDDLEEKLAQAKEE HHHHHHHHHHHHHHH | 39.48 | 22902405 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TPM4_RAT !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TPM4_RAT !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TPM4_RAT !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of TPM4_RAT !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...