UniProt ID | TPD54_RAT | |
---|---|---|
UniProt AC | Q6PCT3 | |
Protein Name | Tumor protein D54 | |
Gene Name | Tpd52l2 | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 220 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MDSASQDINLNSPNKGVLSDFMTDVPVDPGVVHRTPAVEGLTEVEEEELRAELAKVEEEIVTLRQVLAAKERHCGELKRRLGLSTLGELKQNLSRSWHDVQGSTAYVKTSEKLGEWNEKVTQSDLYKKTQETLSQAGQKTSAALSTMGSAISRKLGDMSSYSIRHSISMPVMRNSATFKSFEDRVGTIKSKVVGGRENGSDTLPSSPGSGDQTLPDHAPF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MDSASQDI -------CCCCCCCC | 9.19 | - | |
3 | Phosphorylation | -----MDSASQDINL -----CCCCCCCCCC | 28.64 | 27097102 | |
5 | Phosphorylation | ---MDSASQDINLNS ---CCCCCCCCCCCC | 32.13 | 27097102 | |
12 | Phosphorylation | SQDINLNSPNKGVLS CCCCCCCCCCCCCCH | 32.77 | 30411139 | |
19 | Phosphorylation | SPNKGVLSDFMTDVP CCCCCCCHHHHCCCC | 26.79 | 27097102 | |
23 | Phosphorylation | GVLSDFMTDVPVDPG CCCHHHHCCCCCCCC | 33.56 | 27097102 | |
70 | Acetylation | LRQVLAAKERHCGEL HHHHHHHHHHHHHHH | 50.07 | 22902405 | |
90 | Acetylation | LSTLGELKQNLSRSW CCHHHHHHHHHCCHH | 32.60 | 22902405 | |
96 | Phosphorylation | LKQNLSRSWHDVQGS HHHHHCCHHCCCCCC | 25.95 | 30411139 | |
145 | Phosphorylation | QKTSAALSTMGSAIS HHHHHHHHHHHHHHH | 16.18 | 28432305 | |
146 | Phosphorylation | KTSAALSTMGSAISR HHHHHHHHHHHHHHH | 26.80 | 28432305 | |
149 | Phosphorylation | AALSTMGSAISRKLG HHHHHHHHHHHHHHC | 16.17 | 28432305 | |
152 | Phosphorylation | STMGSAISRKLGDMS HHHHHHHHHHHCCCC | 24.07 | 28432305 | |
166 | Phosphorylation | SSYSIRHSISMPVMR CHHCHHHCCCCCEEC | 13.40 | 28432305 | |
168 | Phosphorylation | YSIRHSISMPVMRNS HCHHHCCCCCEECCC | 21.76 | 29779826 | |
175 | Phosphorylation | SMPVMRNSATFKSFE CCCEECCCCCCCCHH | 20.51 | 28432305 | |
177 | Phosphorylation | PVMRNSATFKSFEDR CEECCCCCCCCHHHH | 31.27 | 28432305 | |
180 | Phosphorylation | RNSATFKSFEDRVGT CCCCCCCCHHHHHCC | 29.67 | 28689409 | |
187 | Phosphorylation | SFEDRVGTIKSKVVG CHHHHHCCCEEEEEC | 23.52 | 23984901 | |
200 | Phosphorylation | VGGRENGSDTLPSSP ECCCCCCCCCCCCCC | 38.72 | 27097102 | |
202 | Phosphorylation | GRENGSDTLPSSPGS CCCCCCCCCCCCCCC | 42.12 | 27097102 | |
205 | Phosphorylation | NGSDTLPSSPGSGDQ CCCCCCCCCCCCCCC | 52.88 | 27097102 | |
206 | Phosphorylation | GSDTLPSSPGSGDQT CCCCCCCCCCCCCCC | 31.19 | 27097102 | |
209 | Phosphorylation | TLPSSPGSGDQTLPD CCCCCCCCCCCCCCC | 42.45 | 27097102 | |
213 | Phosphorylation | SPGSGDQTLPDHAPF CCCCCCCCCCCCCCC | 45.02 | 27097102 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TPD54_RAT !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TPD54_RAT !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TPD54_RAT !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of TPD54_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...