UniProt ID | TOX3_MOUSE | |
---|---|---|
UniProt AC | Q80W03 | |
Protein Name | TOX high mobility group box family member 3 | |
Gene Name | Tox3 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 575 | |
Subcellular Localization | Nucleus . | |
Protein Description | Transcriptional coactivator of the p300/CBP-mediated transcription complex. Activates transactivation through cAMP response element (CRE) sites. Protects against cell death by inducing antiapoptotic and repressing pro-apoptotic transcripts. Stimulates transcription from the estrogen-responsive or BCL-2 promoters. Required for depolarization-induced transcription activation of the C-FOS promoter in neurons. Associates with chromatin to the estrogen-responsive C3 promoter region (By similarity).. | |
Protein Sequence | MDVRFYPAAAGDPAGLDFAQCLGYYGYSKLGNNNYMNMAEANNAFFAASEQTFHTPSLGDEEFEIPPITPPPESDPTLGMPDALLPFQTLSDPLPSQGTEFTPQFPPQSLDLPSITISRNLVEQDGVLHSNGLHMDQSHTQVSQYRQDPSLVMRSIVHMTDGARSGIMPPAQLTTINQSQLSAQLGLNLGGANVSHTSPSPPASKSATPSPSSSINEEDADDANRAIGEKRTAPDSGKKPKTPKKKKKKDPNEPQKPVSAYALFFRDTQAAIKGQNPNATFGEVSKIVASMWDSLGEEQKQVYKRKTEAAKKEYLKALAAYRASLVSKAAAESAEAQTIRSVQQTLASTNLTSSLLLNTSLSQHGTVPASPQTLPQSLPRSIAPKPLTMRLPMSQIVTSVTIAANMPSNIGAPLISSMGTTMVGSATSTQVSPSVQTQQHQMQLQQQQQQQQQMQQMQQQQLQQHQMHQQIQQQMQQQHFQHHMQQHLQQQQQQHLQQQLSQQQLQQQLQQHLQLQQLQHMQHQSQPSPRQHSPVTSQITSPIPAIGSPQPASQQHQPQIQSQTQTQVLPQVSIF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
206 | Phosphorylation | PSPPASKSATPSPSS CCCCCCCCCCCCCCC | 34.57 | 24759943 | |
210 | Phosphorylation | ASKSATPSPSSSINE CCCCCCCCCCCCCCH | 32.81 | 24759943 | |
212 | Phosphorylation | KSATPSPSSSINEED CCCCCCCCCCCCHHH | 40.84 | 24759943 | |
249 | Acetylation | TPKKKKKKDPNEPQK CCCCCCCCCCCCCCC | 83.64 | 8277279 | |
280 | Phosphorylation | KGQNPNATFGEVSKI CCCCCCCCHHHHHHH | 38.52 | - | |
285 | Phosphorylation | NATFGEVSKIVASMW CCCHHHHHHHHHHHH | 16.62 | - | |
338 | Phosphorylation | AESAEAQTIRSVQQT HHHHHHHHHHHHHHH | 25.96 | 28059163 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TOX3_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TOX3_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TOX3_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of TOX3_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...