| UniProt ID | TOX3_MOUSE | |
|---|---|---|
| UniProt AC | Q80W03 | |
| Protein Name | TOX high mobility group box family member 3 | |
| Gene Name | Tox3 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 575 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Transcriptional coactivator of the p300/CBP-mediated transcription complex. Activates transactivation through cAMP response element (CRE) sites. Protects against cell death by inducing antiapoptotic and repressing pro-apoptotic transcripts. Stimulates transcription from the estrogen-responsive or BCL-2 promoters. Required for depolarization-induced transcription activation of the C-FOS promoter in neurons. Associates with chromatin to the estrogen-responsive C3 promoter region (By similarity).. | |
| Protein Sequence | MDVRFYPAAAGDPAGLDFAQCLGYYGYSKLGNNNYMNMAEANNAFFAASEQTFHTPSLGDEEFEIPPITPPPESDPTLGMPDALLPFQTLSDPLPSQGTEFTPQFPPQSLDLPSITISRNLVEQDGVLHSNGLHMDQSHTQVSQYRQDPSLVMRSIVHMTDGARSGIMPPAQLTTINQSQLSAQLGLNLGGANVSHTSPSPPASKSATPSPSSSINEEDADDANRAIGEKRTAPDSGKKPKTPKKKKKKDPNEPQKPVSAYALFFRDTQAAIKGQNPNATFGEVSKIVASMWDSLGEEQKQVYKRKTEAAKKEYLKALAAYRASLVSKAAAESAEAQTIRSVQQTLASTNLTSSLLLNTSLSQHGTVPASPQTLPQSLPRSIAPKPLTMRLPMSQIVTSVTIAANMPSNIGAPLISSMGTTMVGSATSTQVSPSVQTQQHQMQLQQQQQQQQQMQQMQQQQLQQHQMHQQIQQQMQQQHFQHHMQQHLQQQQQQHLQQQLSQQQLQQQLQQHLQLQQLQHMQHQSQPSPRQHSPVTSQITSPIPAIGSPQPASQQHQPQIQSQTQTQVLPQVSIF | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 206 | Phosphorylation | PSPPASKSATPSPSS CCCCCCCCCCCCCCC | 34.57 | 24759943 | |
| 210 | Phosphorylation | ASKSATPSPSSSINE CCCCCCCCCCCCCCH | 32.81 | 24759943 | |
| 212 | Phosphorylation | KSATPSPSSSINEED CCCCCCCCCCCCHHH | 40.84 | 24759943 | |
| 249 | Acetylation | TPKKKKKKDPNEPQK CCCCCCCCCCCCCCC | 83.64 | 8277279 | |
| 280 | Phosphorylation | KGQNPNATFGEVSKI CCCCCCCCHHHHHHH | 38.52 | - | |
| 285 | Phosphorylation | NATFGEVSKIVASMW CCCHHHHHHHHHHHH | 16.62 | - | |
| 338 | Phosphorylation | AESAEAQTIRSVQQT HHHHHHHHHHHHHHH | 25.96 | 28059163 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TOX3_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TOX3_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TOX3_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of TOX3_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...