TOX3_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TOX3_HUMAN
• UniProt AC: O15405
• Protein Name: TOX high mobility group box family member 3
• Gene Name: TOX3
• Organism: Homo sapiens (Human).
• Sequence Length: 576
• Subcellular Localization: Nucleus .
• Protein Description: Transcriptional coactivator of the p300/CBP-mediated transcription complex. Activates transactivation through cAMP response element (CRE) sites. Protects against cell death by inducing antiapoptotic and repressing pro-apoptotic transcripts. Stimulates transcription from the estrogen-responsive or BCL-2 promoters. Required for depolarization-induced transcription activation of the C-FOS promoter in neurons. Associates with chromatin to the estrogen-responsive C3 promoter region..
• Protein Sequence: MDVRFYPAAAGDPASLDFAQCLGYYGYSKFGNNNNYMNMAEANNAFFAASEQTFHTPSLGDEEFEIPPITPPPESDPALGMPDVLLPFQALSDPLPSQGSEFTPQFPPQSLDLPSITISRNLVEQDGVLHSSGLHMDQSHTQVSQYRQDPSLIMRSIVHMTDAARSGVMPPAQLTTINQSQLSAQLGLNLGGASMPHTSPSPPASKSATPSPSSSINEEDADEANRAIGEKRAAPDSGKKPKTPKKKKKKDPNEPQKPVSAYALFFRDTQAAIKGQNPNATFGEVSKIVASMWDSLGEEQKQVYKRKTEAAKKEYLKALAAYRASLVSKAAAESAEAQTIRSVQQTLASTNLTSSLLLNTPLSQHGTVSASPQTLQQSLPRSIAPKPLTMRLPMNQIVTSVTIAANMPSNIGAPLISSMGTTMVGSAPSTQVSPSVQTQQHQMQLQQQQQQQQQQMQQMQQQQLQQHQMHQQIQQQMQQQHFQHHMQQHLQQQQQHLQQQINQQQLQQQLQQRLQLQQLQHMQHQSQPSPRQHSPVASQITSPIPAIGSPQPASQQHQSQIQSQTQTQVLSQVSIF

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
119	Phosphorylation	DLPSITISRNLVEQD CCCCEEEECCHHHCC	13.38	24719451
207	Phosphorylation	PSPPASKSATPSPSS CCCCCCCCCCCCCCC	34.57	28348404
209	O-linked_Glycosylation	PPASKSATPSPSSSI CCCCCCCCCCCCCCC	31.24	29351928
209	Phosphorylation	PPASKSATPSPSSSI CCCCCCCCCCCCCCC	31.24	28348404
211	O-linked_Glycosylation	ASKSATPSPSSSINE CCCCCCCCCCCCCCH	32.81	29351928
211	Phosphorylation	ASKSATPSPSSSINE CCCCCCCCCCCCCCH	32.81	28348404
257	Acetylation	KDPNEPQKPVSAYAL CCCCCCCCCCEEEEE	59.09	26051181
260	Phosphorylation	NEPQKPVSAYALFFR CCCCCCCEEEEEEEH	24.88	28555341
269	Ubiquitination	YALFFRDTQAAIKGQ EEEEEHHHHHHHCCC	18.82	29967540
274	Ubiquitination	RDTQAAIKGQNPNAT HHHHHHHCCCCCCCC	50.12	29967540
282	Ubiquitination	GQNPNATFGEVSKIV CCCCCCCHHHHHHHH	7.94	32015554
287	Ubiquitination	ATFGEVSKIVASMWD CCHHHHHHHHHHHHH	46.50	32015554
315	Phosphorylation	TEAAKKEYLKALAAY HHHHHHHHHHHHHHH	23.53	22817900
322	Phosphorylation	YLKALAAYRASLVSK HHHHHHHHHHHHHHH	10.91	30206219
325	Phosphorylation	ALAAYRASLVSKAAA HHHHHHHHHHHHHHH	21.95	30206219
529	Phosphorylation	MQHQSQPSPRQHSPV HHHCCCCCCCCCCCC	25.69	28348404

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TOX3_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TOX3_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TOX3_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of TOX3_HUMAN !!

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.