UniProt ID | TOPK_MOUSE | |
---|---|---|
UniProt AC | Q9JJ78 | |
Protein Name | Lymphokine-activated killer T-cell-originated protein kinase | |
Gene Name | Pbk | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 330 | |
Subcellular Localization | ||
Protein Description | Phosphorylates MAP kinase p38. Seems to be active only in mitosis. May also play a role in the activation of lymphoid cells. When phosphorylated, forms a complex with TP53, leading to TP53 destabilization (By similarity).. | |
Protein Sequence | MEGINNFKTPNKSEKRKSVLCSTPCVNIPASPFMQKLGFGTGVSVYLMKRSPRGLSHSPWAVKKISLLCDDHYRTVYQKRLTDEAKILKNLNHPNIIGYRAFTEASDGSLCLAMEYGGEKSLNDLIEERNKDSGSPFPAAVILRVALHMARGLKYLHQEKKLLHGDIKSSNVVIKGDFETIKICDVGVSLPLDENMTVTDPEACYIGTEPWKPKEALEENGIITDKADVFAFGLTLWEMMTLCIPHVNLPDDDVDEDATFDESDFDDEAYYAALGTRPSINMEELDDSYQKAIELFCVCTNEDPKDRPSAAHIVEALELDGQCCGLSSKH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MEGINNFK -------CCCCCCCC | 10.84 | - | |
9 | Phosphorylation | EGINNFKTPNKSEKR CCCCCCCCCCCCCCC | 28.14 | 27566939 | |
13 | Phosphorylation | NFKTPNKSEKRKSVL CCCCCCCCCCCCCEE | 55.80 | 24759943 | |
18 | Phosphorylation | NKSEKRKSVLCSTPC CCCCCCCCEEECCCC | 25.10 | 26824392 | |
22 | Phosphorylation | KRKSVLCSTPCVNIP CCCCEEECCCCCCCC | 31.09 | 25266776 | |
23 | Phosphorylation | RKSVLCSTPCVNIPA CCCEEECCCCCCCCC | 21.51 | 24453211 | |
31 | Phosphorylation | PCVNIPASPFMQKLG CCCCCCCCHHHHHHC | 17.20 | 25266776 | |
44 | Phosphorylation | LGFGTGVSVYLMKRS HCCCCCCEEEEEECC | 13.34 | 27600695 | |
51 | Phosphorylation | SVYLMKRSPRGLSHS EEEEEECCCCCCCCC | 17.27 | 27600695 | |
56 | Phosphorylation | KRSPRGLSHSPWAVK ECCCCCCCCCCHHHH | 25.41 | 25159016 | |
58 | Phosphorylation | SPRGLSHSPWAVKKI CCCCCCCCCHHHHHH | 20.82 | 22942356 | |
69 | Glutathionylation | VKKISLLCDDHYRTV HHHHHHHCCHHHHHH | 7.58 | 24333276 | |
121 | Phosphorylation | MEYGGEKSLNDLIEE EECCCCCCHHHHHHH | 28.27 | 22817900 | |
133 | Phosphorylation | IEERNKDSGSPFPAA HHHHHCCCCCCCCHH | 42.66 | 28066266 | |
135 | Phosphorylation | ERNKDSGSPFPAAVI HHHCCCCCCCCHHHH | 27.59 | 28066266 | |
197 | Phosphorylation | LPLDENMTVTDPEAC CCCCCCCCCCCHHHC | 31.66 | 22817900 | |
279 | Phosphorylation | AALGTRPSINMEELD HHHCCCCCCCHHHCC | 24.25 | - | |
288 | Phosphorylation | NMEELDDSYQKAIEL CHHHCCHHHHHHHHH | 29.18 | 28066266 | |
289 | Phosphorylation | MEELDDSYQKAIELF HHHCCHHHHHHHHHH | 22.49 | 28066266 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TOPK_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TOPK_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TOPK_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of TOPK_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...