TOM92_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TOM92_ARATH
• UniProt AC: Q9FNC9
• Protein Name: Mitochondrial import receptor subunit TOM9-2
• Gene Name: TOM9-2
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 99
• Subcellular Localization: Mitochondrion outer membrane ; Single-pass type II membrane protein .
• Protein Description: Central component of the receptor complex responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins. Together with TOM20 functions as the transit peptide receptor at the surface of the mitochondrion outer membrane and facilitates the movement of preproteins into the translocation pore (By similarity)..
• Protein Sequence: MAAKRIGAGKSGGGDPNILARISNSEIVSQGRRAAGDAVEVSKKLLRSTGKAAWIAGTTFLILVVPLIIEMDREAQINEIELQQASLLGAPPSPMQRGL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
11	Phosphorylation	KRIGAGKSGGGDPNI CCCCCCCCCCCCCCH		24894044

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TOM92_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TOM92_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TOM92_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of TOM92_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.